Recombinant Macaca mulatta Interleukin-15(IL15)

Code CSB-YP011593MOW
Product Type Recombinant Protein
Size US$2959
Uniprot No. P48092
Relevance Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Macaca mulatta (Rhesus macaque)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Research Area Others
Source Yeast
Gene Names IL15
Protein Names Recommended name: Interleukin-15 Short name= IL-15
Expression Region 49-162aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 14.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Subcellular Location Secreted
Protein Families IL-15/IL-21 family
Database Links

KEGG: mcc:699616

STRING: 9544.ENSMMUP00000025100

UniGene: Mmu.3414

Pathway Jak-STAT signaling pathway
TNF signaling pathway

Related Products

IL15 Proteins

IL15 Proteins for Macaca mulatta (Rhesus macaque)

IL15 ELISA Kit

IL15 ELISA Kit for Monkey

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.