Home
Protein
Recombinant Proteins
Recombinant Macaca mulatta Interleukin-15 (IL15)

Recombinant Macaca mulatta Interleukin-15 (IL15)

^{In Stock}

Code	CSB-YP011593MOW
Abbreviation	Recombinant Rhesus macaque IL15 protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IL15

Uniprot No.

P48092

Research Area

Others

Alternative Names

IL15; Interleukin-15; IL-15

Species

Macaca mulatta (Rhesus macaque)

Source

Yeast

Expression Region

49-162aa

Target Protein Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

14.9kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The production of this Recombinant Macaca mulatta IL15 protein required the insertion of a DNA fragment (IL15, 49-162aa) into an expression vector and the transferral of this vector into Yeast cells (the step of transformation). The cells were then cultured and induced to express the IL15 protein. This recombinant protein was fused with N-terminal 6xHis tag. Its purity is 90%+ determined by SDS-PAGE.

IL15 is a gene encoding a protein named interleukin-15 (also known as IL-15) in macaca mulatta (rhesus macaque). This gene has many orthologs in multiple mammals, such as human, house mouse, pig, cattle, etc. IL-15 protein is a cytokine with structural similarity to IL-2 that regulates T and natural killer cell activation and proliferation. Like IL-2, IL-15 binds to and functions by a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132).

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA. In neutrophils, stimulates phagocytosis probably by signaling through the IL15 receptor, composed of the subunits IL15RA, IL2RB and IL2RG, which results in kinase SYK activation.

Gene References into Functions

IL 15 generates a dramatic expansion of short-lived memory CD8 T cells and natural killer in immunocompetent macaques and has long-term effects on the balance of CD4(+) and CD8(+) T cells. PMID: 20631381
These data suggest that therapeutic use of IL-15 in the setting of antiretroviral therapy might facilitate specific restoration of the CD4 + T cell compartment. PMID: 16691294
IL-15 secretion significantly correlates with the up-regulated expression of CD4 on memory CD4 T cells that is associated with increased permissiveness to simian immunodeficiency virus infection. PMID: 19155491

Subcellular Location

Secreted.

Protein Families

IL-15/IL-21 family

Database Links

KEGG: mcc:699616

STRING: 9544.ENSMMUP00000025100

UniGene: Mmu.3414

Promotions