Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Cyp24a1

Uniprot No.

Q64441

Research Area

Cancer

Alternative Names

Cytochrome P450 24A1;Cytochrome P450-CC24;24-OHase; Vitamin D

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

36-514aa

Target Protein Sequence

RAPKEVPLCPLMTDGETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFMGQIDELRDERGRIQDLYSELNKWSFESICLVLYEKRFGLLQKDTEEEALTFIAAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDHRLERYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQRLLREIQSVLPDNQTPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYTLPKGTVLTLNTQVLGSSEDNFEDADKFRPERWLEKEKKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIIQKYNIVATDSEPVEMLHLGILVPSRELPIAFCPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

55.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

A cytochrome P450 monooxygenase with a key role in vitamin D catabolism and calcium homeostasis. Via C24-oxidation pathway, catalyzes the inactivation of both the vitamin D precursor calcidiol (25-hydroxyvitamin D(3)) and the active hormone calcitriol (1-alpha,25-dihydroxyvitamin D(3)). With initial hydroxylation at C-24 (via C24-oxidation pathway), performs a sequential 6-step oxidation of calcitriol leading to the formation of the biliary metabolite calcitroic acid. Hydroxylates at C-24 or C-25 other vitamin D active metabolites, such as CYP11A1-derived secosteroids 20S-hydroxycholecalciferol and 20S,23-dihydroxycholecalciferol. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via FDXR/adrenodoxin reductase and FDX1/adrenodoxin.

Gene References into Functions

SREBP1 trans-activates CYP24A1 expression through SREBP binding elements present in the promoter. PMID: 29653103
CYP24A1 activity is not essential for intramembranous bone formation. PMID: 27825991
results link CYP24 activity to the pathophysiology of FGF23-dependent renal phosphate wasting states and implicate pharmacologic CYP24 inhibition as a therapeutic adjunct for their treatment. PMID: 26784541
Gsalpha is required in proximal tubules for suppressing renal vitamin D 24-hydroxylase mRNA levels and for maintaining normal serum 1,25(OH)2D. PMID: 26671181
the mechanism through which 1,25(OH)(2)D(3) induces the CYP24A1 enzyme PMID: 22179019
The expression of vitamin D 24-hydroxylase gene was directly regulated by serum calcium rather than 25-hydroxyvitamin D 1 alpha-hydroxylase. PMID: 21158085
Results show that Inhibition of 24-OHase activity modulates serum calcitriol PK in normal C3H/HeJ mice. PMID: 20591973
Cyp24a1 deficiency delays fracture repair and strongly suggest that vitamin D metabolites hydroxylated at position 24, such as 24,25(OH)2D3, play an important role in the mechanisms leading to normal fracture hea PMID: 20144713
1,25(OH)2D is the preferred substrate for CYP24 in murine kidney mitochondria. PMID: 11774846
findings demonstrate that regulation of both the 25-hydroxyvitamin D-1 alpha-hydroxylase and 25-hydroxyvitamin D-24-hydroxylase genes by phosphorus is disordered in hypophosphatemic mice at the level of renal mRNA expression PMID: 12865326
the absence of CYP24A1 or vitamin D receptor retards catabolism of 1alpha,25(OH)2D3 and 25(OH)D3 PMID: 15498883
xenobiotics and drugs can modulate CYP24 gene expression and alter vitamin D(3) hormonal activity and calcium homeostasis through the activation of pregnane X receptor PMID: 15630458
CYP24A1 can activate and inactivate vitamin D prodrugs in skin and other target cells in vitro PMID: 16516540
Data show that activation of steroid and xenobiotic receptor does not induce cytochrome P450, family 24 (CYP24)-mediated expression, but inhibits vitamin D receptor-mediated CYP24 promoter activity. PMID: 16691293
methylation silencing of CYP24 contributes to selective calcitriol-mediated growth inhibition in endothelial cells PMID: 17244627
Data demonstrate that VDR mediates the anti-proliferative and pro-apoptotic effects of vitamin D metabolites and analogs, but that the potency of a vitamin D compound to induce CYP24 does not accurately predict its potency in mediating growth regulation. PMID: 17286279

Hide All

Subcellular Location

Mitochondrion.

Protein Families

Cytochrome P450 family

Database Links

KEGG: mmu:13081

STRING: 10090.ENSMUSP00000047954

UniGene: Mm.6575

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP714493MOe1
Abbreviation	Recombinant Mouse Cyp24a1 protein
MSDS	MSDS Datasheet
Size	$422
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial(Cyp24a1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage