Recombinant Mouse 14-3-3 protein zeta/delta (Ywhaz)

In Stock
Code CSB-EP026293MO
Abbreviation Recombinant Mouse Ywhaz protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ywhaz14-3-3 protein zeta/delta; Protein kinase C inhibitor protein 1; KCIP-1; SEZ-2
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-245aa
Target Protein Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity.
Gene References into Functions
  1. DEX can increase IOP in mouse eyes and concurrently downregulate 14-3-3 zeta protein expression in mouse TM PMID: 28494163
  2. These results demonstrate that miR-146a enhances class switch and secretion of IgE in B cells by upregulating 14-3-3sigma expression, and suggest that miR-146a may be a potential target for asthma therapy. PMID: 29101850
  3. When taken together these findings demonstrate novel roles of 14-3-3zeta in the regulation of glucose homeostasis and suggest that modulating 14-3-3zeta levels in intestinal L cells may have beneficial metabolic effects through GLP-1-dependent mechanisms. PMID: 27167773
  4. Results indicate that HuR induces 14-3-3zeta translation via interaction with its 3' UTR and that 14-3-3zeta is necessary for stimulation of intestinal epithelial cell migration after wounding. PMID: 27401462
  5. PKCdelta-mediated phosphorylation of 14-3-3zeta contributes to the nuclear retention of FOXO1, even when FOXO1 is phosphorylated as under non-stress conditions PMID: 26363783
  6. 14-3-3zeta deficient mice in the BALB/c background display behavioral and anatomical defects associated with Schizophrenia-like disorder. PMID: 26207352
  7. Ywhaz coordinates adipogenesis in visceral fat. PMID: 26220403
  8. An essential role for 14-3-3 zeta in the regulation of macropinocytosis in macrophages upon cytokine stimulation through modulation of the localization of coronin 1. PMID: 25645340
  9. In the majority of NAFLD treatment groups and time points the most stable gene was YWHAZ. PMID: 22583519
  10. By preventing the inactivation of cofilin, metabolic stress-induced degradation of 14-3-3zeta promotes the conversion of blood monocytes into a hypermigratory, proatherogenic phenotype. PMID: 24812321
  11. 14-3-3zeta KO mice displayed enhanced locomotor hyperactivity induced by the dopamine (DA) releaser amphetamine. Consistent with 14-3-3zeta having a role in DA signalling, we found increased levels of DA in the striatum of 14-3-3zeta KO mice. PMID: 24301645
  12. The activated serine/threonine kinase Akt/protein kinase B phosphorylated BTK on two sites prior to 14-3-3 zeta binding. PMID: 23754751
  13. studies demonstrate that increased 14-3-3zeta levels protect against ER stress and seizure-damage despite down-regulation of the unfolded protein response PMID: 23359526
  14. Multiple tumor-associated microRNAs modulate the survival and longevity of dendritic cells by targeting YWHAZ and Bcl2 signaling pathways. PMID: 23355742
  15. 14-3-3 zeta as the only prognosticator of local recurrence-free survival (LRFS) and also an independently predicted factor of disease-specific survival (DSS). PMID: 21322651
  16. results suggest that 14-3-3zeta, a novel direct binding partner of the L1ICD, promotes L1 phosphorylation by CKII in the central nervous system, and regulates neurite outgrowth, an important biological process triggered by L1 PMID: 20976158
  17. Mutation of the 14-3-3 zeta phosphorylation sites in Smad3 markedly reduced the 14-3-3-zeta-mediated inhibition of TGF-beta1-induced p15 promoter-reporter activity & cell cycle arrest in mammary epithelial cells. PMID: 20082218
  18. an essential role of 14-3-3zeta as a mediator of the proerythroid differentiation actions of miR-451 PMID: 20679397
  19. in miR-144/451(-/-) erythroblasts, 14-3-3zeta accumulates, causing partial relocalization of FoxO3 from nucleus to cytoplasm with dampening of its transcriptional prog PMID: 20679398
  20. 14-3-3zeta controls CCTalpha nuclear import in response to calcium signals, thereby regulating mammalian phospholipid synthesis. PMID: 20007511
  21. 14-3-3 binds to phosphorylated Raf-1, blocking Raf-1 recruitment to the plasma membrane and preventing its activation PMID: 12801936
  22. 14-3-3zeta has a role in MAPKAPK2-mediated phosphorylation, which may represent a novel pathway mediating p38 MAPK-dependent inflammation PMID: 12861023
  23. dimeric versus monomeric status of 14-3-3zeta is controlled by phosphorylation of Ser58 at the dimer interface PMID: 12865427
  24. 14-3-3 was identified as a binding partner of MITF in osteoclast precursors, and overexpression of 14-3-3 in a transgenic model resulted in increased cytosolic localization of MITF and decreased expression of MITF target genes [14-3-3 zeta] PMID: 16822840
  25. 14-3-3:Shc scaffolds can act as multivalent signaling nodes for the integration of both phosphoserine/threonine and phosphotyrosine pathways to regulate specific cellular responses. PMID: 19218246
  26. Caspase-2 phosphorylated at S135 binds 14-3-3zeta, thus preventing C2 dephosphorylation. PMID: 19531356

Show More

Hide All

Subcellular Location
Cytoplasm. Melanosome.
Protein Families
14-3-3 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*