Recombinant Mouse Inactive 2'-5'-oligoadenylate synthase 1B (Oas1b), partial

Product Details

Purity

≥85% (SDS-PAGE)

Target Names

Oas1b

Uniprot No.

Alternative Names

Oas1b; Flv; Oias2; Inactive 2'-5'-oligoadenylate synthase 1B; (2-5')oligo(A) synthase 1B; 2-5A synthase 1B; 2'-5'-oligoadenylate synthase-like protein 1

Species

Mus musculus (Mouse)

Expression Region

1-351aa

Target Protein Sequence

MEQDLRSIPASKLDKFIENHLPDTSFCADLREVIDALCALLKDRSFRGPVRRMRASKGVKGKGTTLKGRSDADLVVFLNNLTSFEDQLNQQGVLIKEIKKQLCEVQHERRCGVKFEVHSLRSPNSRALSFKLSAPDLLKEVKFDVLPAYDLLDHLNILKKPNQQFYANLISGRTPPGKEGKLSICFMGLRKYFLNCRPTKLKRLIRLVTHWYQLCKEKLGDPLPPQYALELLTVYAWEYGSRVTKFNTAQGFRTVLELVTKYKQLQIYWTVYYDFRHQEVSEYLHQQLKKDRPVILDPADPTRNIAGLNPKDWRRLAGEAAAWLQYPCFKYRDGSSVCSWEVPTEVGVPMK

Protein Length

Partial

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Does not have 2'-5'-OAS activity, but can bind double-stranded RNA. The full-length protein displays antiviral activity against flaviviruses such as west Nile virus (WNV) via an alternative antiviral pathway independent of RNase L. The truncated form of the protein lacks antiviral activity.

Gene References into Functions

Oas1b status as wild-type or truncated, and overall Oas1b gene dosage, link with novel innate immune gene signatures that impact specific biological pathways for the control of flavivirus infection and immunity through both Oas1b-dependent and independent processes. PMID: 28592649
These data indicate that the different susceptibility to the antiviral activity of Oas1b resulted in a difference in neurovirulence in the two tick-borne encephalitis virus strains. PMID: 23266832
Oas1b is part of a complex located in the ER and that ABCF3 is a component of the Flv(r)-mediated resistance mechanism. PMID: 22623793
Activation of Oas1b gene expression by type I IFN requires only STAT2, not STAT1. PMID: 22305621
Oas1b inhibits flavivirus replication by an alternative mechanism that overrides the proviral effect of reducing 2-5A accumulation and RNase L activation. PMID: 21056894
A positional cloning strategy was used to identify 22 genes from the Flv gene interval including 10 members of the 2'-5'-oligoadenylate synthetase gene family. PMID: 12080145
A nonsense mutation in the gene is associated with West Nile virus susceptibility in laboratory mice PMID: 12186974
Oas1b represents an antiviral pathway that exerts its inhibitory effect on West Nile virus replication by preventing viral RNA accumulation inside infected cells PMID: 16371364
Knock-in of the Oas1b resistance allele into a susceptible mouse strain produced mice with the flavivirus resistance phenotype, confirming that this phenotype is mediated by a single gene. PMID: 17904183
Oas1b mice show resistance to the infection of West Nile virus but not of influenza virus. PMID: 19827744

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Single-pass type IV membrane protein.

Protein Families

2-5A synthase family

Tissue Specificity

Highly expressed in lung, spleen and thymus. Also detected at lower levels in heart, kidney, liver, lung, skeletal muscle, testes, uterus and ovaries.

Database Links

KEGG: mmu:23961

STRING: 10090.ENSMUSP00000083564

UniGene: Mm.233471

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-YP736752MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP736752MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP736752MO-B
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP736752MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP736752MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Inactive 2'-5'-oligoadenylate synthase 1B (Oas1b), partial

Product Details

Customer Reviews and Q&A

Target Background

×CloseMessage