Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
Hmgcr; 3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMG-CoA reductase; EC 1.1.1.34
Species
Mus musculus (Mouse)
Expression Region
700-860aa
Target Protein Sequence
GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 700-860 constitute the expression domain of recombinant Mouse Hmgcr. This Hmgcr protein is expected to have a theoretical molecular weight of 20.4 kDa. This Hmgcr recombinant protein is manufactured in e.coli. The Hmgcr gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant Hmgcr protein during the following stages.
3-hydroxy-3-methylglutaryl-coenzyme A reductase (Hmgcr) in mice is a key enzyme in the mevalonate pathway, responsible for catalyzing the conversion of HMG-CoA to mevalonate. This process is a critical step in cholesterol biosynthesis and regulation. Hmgcr plays a central role in controlling cellular cholesterol levels, as it is subject to feedback regulation by cholesterol levels in the cell. Additionally, the mevalonate pathway is essential for the synthesis of various isoprenoids, including ubiquinone and dolichol, which have diverse cellular functions. Given its pivotal role in cholesterol homeostasis and broader cellular processes, Hmgcr is a target for pharmacological interventions, particularly in the development of statin drugs used to lower cholesterol levels and prevent cardiovascular diseases.
