Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Hmgcr

Uniprot No.

Q01237

Research Area

Cardiovascular

Alternative Names

Hmgcr; 3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMG-CoA reductase; EC 1.1.1.34

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

700-860aa

Target Protein Sequence

GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

20.4 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 700-860 constitute the expression domain of recombinant Mouse Hmgcr. This Hmgcr protein is expected to have a theoretical molecular weight of 20.4 kDa. This Hmgcr recombinant protein is manufactured in e.coli. The Hmgcr gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant Hmgcr protein during the following stages.

3-hydroxy-3-methylglutaryl-coenzyme A reductase (Hmgcr) in mice is a key enzyme in the mevalonate pathway, responsible for catalyzing the conversion of HMG-CoA to mevalonate. This process is a critical step in cholesterol biosynthesis and regulation. Hmgcr plays a central role in controlling cellular cholesterol levels, as it is subject to feedback regulation by cholesterol levels in the cell. Additionally, the mevalonate pathway is essential for the synthesis of various isoprenoids, including ubiquinone and dolichol, which have diverse cellular functions. Given its pivotal role in cholesterol homeostasis and broader cellular processes, Hmgcr is a target for pharmacological interventions, particularly in the development of statin drugs used to lower cholesterol levels and prevent cardiovascular diseases.

Target Background

Function

Catalyzes the conversion of (3S)-hydroxy-3-methylglutaryl-CoA (HMG-CoA) to mevalonic acid, the rate-limiting step in the synthesis of cholesterol and other isoprenoids, thus plays a critical role in cellular cholesterol homeostasis.

Gene References into Functions

Deletion of HMGCR expression in T cells led to a severe decrease in their numbers with the remaining cells displaying an activated phenotype, with an increased proportion of regulatory T cells (Tregs) in particular. PMID: 28542128
these studies designate sterol-accelerated degradation of HMGCR as a potential therapeutic target for prevention of atherosclerosis and associated cardiovascular disease. PMID: 27129778
To eludicate the mechanisms underlying statin myotoxicity and HMGCR function in skeletal muscle, we developed the skeletal muscle-specific HMGCR knockout mice. PMID: 26381177
High-dose simvastatin inhibits HMGCoA reductase and prevents experimental hyperinflation lung injury by angioprotective and anti-inflammatory effects. PMID: 25848815
TSH can regulate the phosphorylation of HMGCR via AMPK. PMID: 25713102
HMGCR proteasomal-degradation by IFN strictly requires the synthesis of endogenous 25-Hydroxycholesterol. PMID: 25759117
Increased cholesterol synthesis mediated by HMGCoA-R under inflammatory stress may be one of the mechanisms for intracellular lipid accumulation and statin resistance. PMID: 24233489
we consistently observe involvement of gp78 in Insig-1 degradation, we find no substantive evidence to support roles for either gp78 or TRC8 in the robust sterol-accelerated degradation of HMG-CoA reductase. PMID: 23087214
Hepatocyte HMGCR is essential for the survival of mice, and its abrogation elicits hepatic steatosis with jaundice and hypoglycemia. PMID: 22701022
Linalool reduces the expression of 3-hydroxy-3-methylglutaryl CoA reductase via sterol regulatory element binding protein-2- and ubiquitin-dependent mechanisms. PMID: 21944868
mechanistic basis for the differential Hmgcr expression in these mouse models of human essential hypertension and implications for better understanding the role of this gene in regulation of blood pressure PMID: 21304971
HMG-CoA reductase is crucial for early development of the mouse embryos PMID: 12920113
Docosahexaenoic acid may enhance brain HMG-CoA reductase activity in aged mice. PMID: 17142030
macrophages from diabetic mice demonstrate increased oxidative stress and increased expression HMG-CoA reductase PMID: 17258748
simvastatin-mediated inhibition of HMGR activity in acutely regenerating tissue of wounded mice was paralleled by a marked loss of VEGF protein expression and disturbances of normal proliferation processes in wound margin keratinocytes during skin repair. PMID: 18390541
renal ischemia/reperfusion activates the HMGCR gene via multiple stress-activated transcriptional and epigenetic pathways, contributing to renal cholesterol loading. PMID: 19095962
Cholesterol synthesis was blocked in culture by inhibiting the activity of HMG CoA reductase (HMGCR) resulting in germ cell survival and migration defects PMID: 19117526
localization in brain and brain peroxisomes PMID: 11559353

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein. Peroxisome membrane; Multi-pass membrane protein.

Protein Families

HMG-CoA reductase family

Database Links

KEGG: mmu:15357

STRING: 10090.ENSMUSP00000022176

UniGene: Mm.316652

Code	CSB-EP010565MO1
Abbreviation	Recombinant Mouse Hmgcr protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse 3-hydroxy-3-methylglutaryl-coenzyme A reductase (Hmgcr), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage