Recombinant Mouse Acyl-CoA desaturase 1 (Scd1), partial

In Stock
Code CSB-EP319560MO1
Abbreviation Recombinant Mouse Scd1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Scd1
Uniprot No.
Research Area
Cancer
Alternative Names
Scd1; Acyl-CoA desaturase 1; Delta(9-desaturase 1; Delta-9 desaturase 1; Fatty acid desaturase 1; Stearoyl-CoA desaturase 1
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
260-355aa
Target Protein Sequence
VNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Constructing a plasmid that codes for the Mouse Scd1 protein (260-355aa) initiates the generation of the recombinant Mouse Scd1 protein. The constructed plasmid is transformed into 260-355aa cells. Positive e.coli cells are selected and then cultured under conditions that encourage the expression of the gene of interest. The protein is equipped with a N-terminal 10xHis tag and C-terminal Myc tag. After that, affinity purification is employed to isolate and purify the recombinant Scd1 protein from the cell lysate. The purity of the resulting recombinant Scd1 protein is over 85%, determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stearoyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the Delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Plays an important role in lipid biosynthesis. Plays an important role in regulating the expression of genes that are involved in lipogenesis and in regulating mitochondrial fatty acid oxidation. Plays an important role in body energy homeostasis. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides. Required for normal development of sebaceous glands. Required for the biosynthesis of normal levels of Delta-9 unsaturated fatty acids and 1-alkyl-2,3-diacylglycerol in the Harderian gland. Required for normal production of meibum, an oily material that prevents drying of the cornea.
Gene References into Functions
  1. intestinal SCD1 to be required for synthesis of oleate in the enterocytes and maintenance of fatty acid homeostasis. Dietary supplementation with oleic acid reduces intestinal inflammation and tumor development in mice. PMID: 30063922
  2. Experimental models in mice and human epithelial cells suggest that inhibition of stearoyl-coenzyme A desaturase activity leads to airway hyper-responsiveness and reduced antiviral defense. PMID: 28397284
  3. leucine deprivation induces the expression of miR-212-5p in a GCN2/ATF4-dependent manner. miR-212-5p suppresses lipid accumulation in liver by targeting FAS and SCD1 under both normal diet and high-fat diet conditions. PMID: 28667176
  4. The aggravated steatosis in Trif(-/-) mice was due to the increased hepatocyte transcription of the gene encoding stearoyl-coenzyme A (CoA) desaturase 1 (SCD1), the rate-limiting enzyme for lipogenesis. PMID: 28790196
  5. A positive correlation among EGFR activation, SCD1 Y55 phosphorylation and SCD1 protein expression. PMID: 28724430
  6. BTG1 has a role in regulating hepatic lipid metabolism and in preventing ATF4 and SCD1 from inducing liver steatosis PMID: 27188441
  7. SCD1 is a key player in the development of alcoholic fatty liver disease. PMID: 27477676
  8. SCD1 ablation/inhibition decreased cardiac lipid content. PMID: 27751891
  9. Our data provide evidence that SCD1 has a broad impact on WAT lipid handling by altering TAG composition in a depot-specific manner, reducing FA reesterification, and regulating markers of lipolysis and glyceroneogenesis. PMID: 28659287
  10. SCD expressed by HSCs promoted liver tumor development in mice. PMID: 28143772
  11. investigated the effect of genetic ablation of SCD1 in 3T3-L1 adipocytes on membrane microdomain lipid composition at the species-specific level PMID: 27632198
  12. Splenic effector T cells (CD4(+)CD25(-)) from age- and sex-matched wild-type (WT) and Scd1KO mice were isolated by FACS and intraperitoneally administered to Rag1KO mice, which were monitored for the development of colitis. At day 60 postcell transfer, Rag1KO mice that received Scd1KO CD4(+)CD25(-) T cells displayed accelerated and exacerbated colitis than mice receiving WT CD4(+)CD25(-) T cells. PMID: 27609767
  13. Scd1 protects cells against lipotoxicity-mediated apoptosis in proximal tubular cells. PMID: 27834856
  14. Scd1 Is Regulated by Dbc1 and SirT1. PMID: 26074075
  15. Study provides new insights into the critical role of SCD1 as a regulator of adipocyte function and lipid metabolism. PMID: 25959085
  16. The study reports report the 3.25-A crystal structure of human SCD1 in complex with its substrate, stearoyl-coenzyme A, which defines the new SCD1 dimetal catalytic center and reveals the determinants of substrate binding. PMID: 26098317
  17. SCD1 is a novel oncogenic factor specifically required for tumor cell viability in anaplastic thyroid carcinoma. PMID: 25675381
  18. crystal structure of mouse SCD1 bound to stearoyl-CoA at 2.6 A resolution PMID: 26098370
  19. Data indicate that lowering stearoyl-CoA desaturase-1 (SCD-1) activity specifically activates p38 mitogen-activated protein kinase (P38MAPK). PMID: 25678624
  20. Results provide new mechanistic insight into the role of SCD1 as a regulator of fatty acid profiles and Triacylglycerol (TG) synthesis in adipocytes, and reinforce that modulating SCD1 activity may help reduce the risk of obesity-related complications. PMID: 24566853
  21. Data indicate that global DNA methylation level in adipocytes depends on stearoyl-CoA desaturase 1 (SCD1) expression/activity. PMID: 25130896
  22. Results show that SCD1 was expressed selectively in the S3 segment of proximal tubule cells, and SCD1 abundance was increased in uromodulin-associated kidney disease affected kidneys. PMID: 25409434
  23. Data indicate that hepatic stearoyl-CoA desaturase 1 (SCD1) expression was decreased in cytochrome P450 1B1 (CYP1B1)-null mice. PMID: 24684199
  24. Data show that liver X receptor (LXR) agonist TO901317 increases hepatic fatty acid desaturation via induction of stearoyl CoA desaturase-1 (SCD1) expression in an LXRalpha-dependent and sterol regulatory element-binding protein 1c (SREBP1c)-mediated manner. PMID: 23945440
  25. results suggest that SCD1 activity is required for the earliest step of autophagosome formation PMID: 25023287
  26. mRNA and protein levels of stearoyl-coenzyme A desaturase 1 are significantly elevated in the tsc2(-/-) MEFs compared with Tsc2(+/+) mouse embryonic fibroblasts PMID: 24296537
  27. Hepatic expression of Scd1 is differentially affected by carbohydrate- and lipid content of the diet. PMID: 23803969
  28. This minireview summarizes the role of skin SCD1 in regulating skin integrity and whole body energy homeostasis and offers a discussion of potential pathways that may connect these seemingly disparate phenotypes. PMID: 24356954
  29. SCD1 overexpression is associated with increased muscle triglyceride content. PMID: 23918045
  30. Increased levels of SCD1 enhance osteogenesis in bone marrow-mesenchymal stem cells. PMID: 24088802
  31. The protective effect of TO901317 was lost after gene silencing of Scd-1/-2, thereby confirming that the protective effect of TO901317 is mediated by Scd-1/-2. PMID: 23867797
  32. Gamma-tocotrienol showed attenuation of triglyceride through effect on fatty acid synthase, sterol regulatory element-binding transcription factor 1, stearoyl CoA desaturase 1, and carnitine palmitoyl transferase 1A gene expression in Hepa 1-6 cells. PMID: 23727646
  33. Monounsaturated fatty acids generated via stearoyl CoA desaturase-1 are endogenous inhibitors of fatty acid amide hydrolase. PMID: 24191036
  34. Systemic down-regulation of delta-9 desaturase promotes muscle oxidative metabolism and accelerates muscle function recovery following nerve injury. PMID: 23785402
  35. In vivo studies using germline (Creb1(-/-) ) and lung epithelial-specific (Creb1(EpiDelta/Delta) ) Creb1 knockout mice showed strongly reduced Scd1, but not Fasn gene expression and protein levels in lung epithelial cells. PMID: 23637738
  36. macrophage-specific SCD1 overexpression promotes overall RCT through increased cholesterol efflux to HDL, suggesting that macrophage SCD1 achieves an anti-atherogenic effect by enhancing RCT. PMID: 23747827
  37. a critical role for Scd1 in functional regulation of leukemia stem cells PMID: 22431519
  38. Thyroid hormone negatively regulates human SCD-1 gene expression in without direct binding of the TH receptor to the SCD-1 gene promoter. PMID: 23221600
  39. SCD1 deletion from adipose and/or liver is insufficient to elicit protection from obesity PMID: 22669918
  40. analysis of potent and liver-selective stearoyl-CoA desaturase (SCD) inhibitors in an acyclic linker series PMID: 22101133
  41. Repression of SCD1 by alpha-linolenic acid favorably increased cholesterol efflux and decreased cholesterol accumulation in foam cells. PMID: 21658928
  42. aryl hydrocarbon receptor regulation of Scd1 not only alters lipid composition but also contributes to the hepatotoxicity of 2,3,7,8-tetrachlorodibenzo-rho-dioxin. PMID: 21890736
  43. Overexpression of KLF15 transcription factor in adipocytes of mice results in down-regulation of SCD1 protein expression in adipocytes and consequent enhancement of glucose-induced insulin secretion. PMID: 21862590
  44. Skin-specific Scd1 knockout (SKO) mice still remain resistant to obesity. PMID: 21573029
  45. TR4 transactivation is inhibited via phosphorylation by metformin-induced AMP-activated protein kinase (AMPK) at the amino acid serine 351, which results in the suppression of SCD1 gene expression. PMID: 21478464
  46. SCD-1 activity is required for efficient cholesterol esterification to monounsaturated fatty acids and that loss of its activity increases Xbp-1s-mediated free cholesterol synthesis. PMID: 20923962
  47. Data from gene knockdown experiments suggest Scd1 is important in the beta-cell response to physiological stress. PMID: 20920255
  48. adipose-specific deletion of SCD1 induces GLUT1 up-regulation in adipose tissue, suggesting that GLUT1 may play a critical role in controlling glucose homeostasis of adipose tissue in adipose-specific SCD1-deficient conditions. PMID: 20655875
  49. Data suggest that the increased food intake and increased energy expenditure of Scd1-/- mice are independent of the neuropeptide melanin-concentrating hormone. PMID: 19883709
  50. findings show show that stearoyl-CoA desaturase-SCD is involved in beta cell cytoprotective mechanism to fatty acid toxicity through its ability to transfer saturated FA into monounsaturated FA that are incorporated in lipids PMID: 19787047

Show More

Hide All

Involvement in disease
Defects is Scd1 are the cause of asebia (ab) (PubMed:17738154, PubMed:10545940, PubMed:10854228, PubMed:10899171, PubMed:15278437). The trait is due to spontaneous autosomal recessive mutations that give rise to deletions or point mutations in Scd1. The ab trait has complete penetrance (PubMed:17738154). Ab mice are characterized by reduced body weight, extreme sebaceous gland hypoplasia leading to nearly complete absence of sebaceous glands, and thickened, scaly skin with hyperkeratosis and alopecia (PubMed:17738154, PubMed:10854228, PubMed:15278437). The hair follicles are abnormally long and extend at a sharp angle into the subcutis, probably due to abnormal persistence of inner root sheath. Frequently the hair shaft ruptures through the base of the hair follicle, giving rise to inflammation that results in scarring alopecia (PubMed:10854228, PubMed:15278437). Besides, ab mice display increased transepithelial water loss (PubMed:10854228). Ab mice present a narrow eye fissure and their eyes are nearly closed (PubMed:10854228, PubMed:15278437). Older mice develop blindness (PubMed:17738154). Scd1 activity is almost absent in liver, and is not compensated by expression of another family member (PubMed:10899171). Liver levels of total cholesterol esters are decreased by 87%, while plasma cholesterol levels are increased by 35% (PubMed:10899171). Likewise, skin sterol esters and diol diesters are strongly reduced (PubMed:10854228). Liver triglyceride levels are decreased by 62%, while plasma triglyceride levels are decreased by 67% (PubMed:10899171). The fatty acid composition of liver triglycerides is altered, with a decrease of about 85% in palmitoleate (C16:1) and oleate (C18:1) levels (PubMed:10899171). These defects cannot be compensated by a diet enriched in unsaturated fatty acids (PubMed:10899171, PubMed:11441127).
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane.
Protein Families
Fatty acid desaturase type 1 family
Tissue Specificity
Detected in liver (at protein level). Detected in skin and liver. Detected in sebaceous gland, but not in hair follicle. Detected in white and brown adipose tissue, eyelid, Harderian gland, and at lower levels in Meibomian gland, eyeball and adrenal gland
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*