Recombinant Mouse Allergin-1 (Milr1), partial

Code CSB-YP662302MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP662302MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP662302MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP662302MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Milr1
Uniprot No.
Alternative Names
Milr1; Gm885; Mca32; Allergin-1; Allergy inhibitory receptor 1; Mast cell antigen 32; MCA-32; Mast cell Ag-32; Mast cell immunoglobulin-like receptor 1
Species
Mus musculus (Mouse)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you quote CSB-BP662302MO?
Can we make it with C-term His tag?

A:
Thanks for your inquiry. We could provide this protein with C-terminal His-tag. The product details are as below.
Code: CSB-BP662302MO
Name: Recombinant Mouse Allergin-1(Milr1),partial
Expression Region: 34-150aa; Fragment; Complete extracellular domain
Tag Info: C-terminal His-tag
Expression Sequence:

ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS


Shipping format: The default delivery form is liquid form. If you have demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)?
With our endotoxin removal service we guarantee the endotoxin level to be less than 0.1ng/ug (1EU ug).
Both aseptic processing and endotoxin removal services are free of charge, however they must be requested when the order is placed.
Shipping condition: These products are routinely shipped on ice packs.
Purity: The minimum purity that we can guarantee is 85% as determined by SDS-PAGE.
We adopt Nickel column affinity chromatography method for protein purification, we will decide if it needs a secondary AKTA-SEC purification by the SDS-PAGE result of the initial purity above 85%.
If the initial purity SDS-PAGE result is already qualified for the QC standard (>85%), and you don’t remark any strict requirement on the purity, generally we will not conduct AKTA-SEC for secondary purification. The final purity will be shown on the COA report.
Free Service: Endotoxin removal, Filter-sterilization, Lyophilization (Note: Lyophilization and filter-sterilization can’t be met at the same time)

Target Background

Function
Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.
Gene References into Functions
  1. The results suggest that Allergin-1 on skin MCs suppresses TLR2-induced dermatitis. PMID: 27932517
  2. It is a immunoglobulin-like receptor which regulates the activation of mast cell.(review) PMID: 24552759
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Tissue Specificity
Expressed in myeloid cells (dendritic cells, macrophages and neutrophils but not in T-cells, B-cells or natural killer cells) and mast cells (at protein level).
Database Links

KEGG: mmu:380732

UniGene: Mm.343952

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1