Recombinant Mouse Allergin-1 (Milr1), partial

Thanks for your inquiry. We could provide this protein with C-terminal His-tag. The product details are as below.
Code: CSB-BP662302MO
Name: Recombinant Mouse Allergin-1(Milr1),partial
Expression Region: 34-150aa; Fragment; Complete extracellular domain
Tag Info: C-terminal His-tag
Expression Sequence:

ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS

Shipping format: The default delivery form is liquid form. If you have demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)?
With our endotoxin removal service we guarantee the endotoxin level to be less than 0.1ng/ug (1EU ug).
Both aseptic processing and endotoxin removal services are free of charge, however they must be requested when the order is placed.
Shipping condition: These products are routinely shipped on ice packs.
Purity: The minimum purity that we can guarantee is 85% as determined by SDS-PAGE.
We adopt Nickel column affinity chromatography method for protein purification, we will decide if it needs a secondary AKTA-SEC purification by the SDS-PAGE result of the initial purity above 85%.
If the initial purity SDS-PAGE result is already qualified for the QC standard (>85%), and you don’t remark any strict requirement on the purity, generally we will not conduct AKTA-SEC for secondary purification. The final purity will be shown on the COA report.
Free Service: Endotoxin removal, Filter-sterilization, Lyophilization (Note: Lyophilization and filter-sterilization can’t be met at the same time)