Recombinant Mouse Alpha-crystallin A chain (Cryaa)

In Stock
Code CSB-EP006007MO
Abbreviation Recombinant Mouse Cryaa protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Cryaa
Uniprot No.
Research Area
Cancer
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-196aa
Target Protein Sequence
MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPVKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Contributes to the transparency and refractive index of the lens. Acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions. Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA.
Gene References into Functions
  1. findings offer additional insight into the early transcriptional changes caused by Cryaa and Cryab mutations associated with autosomal dominant cataracts, and indicate that the transcript levels of certain genes are affected by the expression of mutant alpha-crystallin in vivo PMID: 29338044
  2. Collectively, these studies show that FGF signaling up-regulates expression of alphaA-crystallin both directly and indirectly via up-regulation of c-Maf. PMID: 26719333
  3. Knockout of alphaA-crystallin inhibited pathologic neovascularization through the VEGF and VEGFR2 signaling pathways both in vitro and in vivo. PMID: 25574047
  4. the expression of alphaAN101D transgene results in disruption of lens morphogenesis, which is characterized by defective LEC proliferation, elongation, and lens fiber cell denucleation. PMID: 25146988
  5. p53 can regulate lens differentiation by controlling expression of the differentiation genes coding for the lens crystallins. PMID: 23745585
  6. Alpha A crystallin is a moonlighting protein that functions as a heat shock protein as well as a lens crystalline. PMID: 9695791
  7. alphaA-crystallin may protect against geographic atrophy. PMID: 22916220
  8. The expression patterns of lens crystallins were time- and strain-dependent but different from that of corneal crystallins in mouse corneal neovascularization models. PMID: 22465406
  9. alphaA and alphaB regulate caspase-3 and Bax in vitro and in vivo to regulate lens differentiation. PMID: 22280356
  10. Despite being overexpressed, the molecular properties of alpha-crystallins are disrupted by diabetes and contribute to the loss of neuroprotective function. PMID: 21467180
  11. these findings show that mutation of alphaA-crystallin induces activation of the UPR during cataract formation. PMID: 20833134
  12. Hydroimidazolone modification of human alphaA-crystallin: Effect on the chaperone function and protein refolding ability. PMID: 20085807
  13. Methionine oxidation of alpha-crystallin in combination with loss of MsrA repair causes loss of alpha-crystallin chaperone function. PMID: 19733220
  14. alphaA expression in vivo protects against cell death during mitosis in the lens epithelium PMID: 12584250
  15. mouse lens epithelial cell progression through the cell cycle is significantly affected by expression of alphaA and alphaB-crystallin PMID: 15543941
  16. tissue-specific expression of alphaA-crystallin is regulated by recruitment of Pax6 and c-Maf PMID: 16023139
  17. Alpha-crystallin plays a role in suppressing caspase activity, resulting in retention of lens fiber cell integrity following degradation of mitochondria and other organelles during the apoptosis-like pathway of lens cell terminal differentiation. PMID: 16439475
  18. The role of Cryab AND Cryaa in microtubule assembly is reported. PMID: 16675842
  19. Data suggest that moderate level of alphaA-crystallin gene expression in lens epithelial cells does not require the presence of CBP and p300 in the promoter. PMID: 17467007
  20. alphaA-crystallin regulates epithelial sodium channel expression PMID: 17664274
  21. Tau expression increases in the alpha-crystallin knockout lenses, suggesting that alphaA- and alphaB-crystallins are potentially important regulators of tau expression in lens. PMID: 17893660
  22. A modified genomic fragment of 15-kilobase Cryaa/enhanced green fluorescent protein (EGFP) is sufficient to direct the earliest onset of alphaA-crystallin/EGFP expression in the lens pit. PMID: 18803847
  23. Decreased gene expression of Cryaa and Cryab in the lens is associated with the development of cataract in OXYS rats. PMID: 19120020
  24. expression of R49C CRYAA mutant protein in the presence of the neor gene causes posterior cataracts with posterior migration of epithelial cell nuclei, and demonstrates that the mutant protein affects the integrity of lens fiber cells in the deep cortex. PMID: 19619312

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Small heat shock protein (HSP20) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*