Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Cryaa

Uniprot No.

P24622

Research Area

Cancer

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-196aa

Target Protein Sequence

MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPVKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.4 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Datasheet & COA

Please contact us to get it.

Target Background

Function

Contributes to the transparency and refractive index of the lens. Acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions. Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA.

Gene References into Functions

findings offer additional insight into the early transcriptional changes caused by Cryaa and Cryab mutations associated with autosomal dominant cataracts, and indicate that the transcript levels of certain genes are affected by the expression of mutant alpha-crystallin in vivo PMID: 29338044
Collectively, these studies show that FGF signaling up-regulates expression of alphaA-crystallin both directly and indirectly via up-regulation of c-Maf. PMID: 26719333
Knockout of alphaA-crystallin inhibited pathologic neovascularization through the VEGF and VEGFR2 signaling pathways both in vitro and in vivo. PMID: 25574047
the expression of alphaAN101D transgene results in disruption of lens morphogenesis, which is characterized by defective LEC proliferation, elongation, and lens fiber cell denucleation. PMID: 25146988
p53 can regulate lens differentiation by controlling expression of the differentiation genes coding for the lens crystallins. PMID: 23745585
Alpha A crystallin is a moonlighting protein that functions as a heat shock protein as well as a lens crystalline. PMID: 9695791
alphaA-crystallin may protect against geographic atrophy. PMID: 22916220
The expression patterns of lens crystallins were time- and strain-dependent but different from that of corneal crystallins in mouse corneal neovascularization models. PMID: 22465406
alphaA and alphaB regulate caspase-3 and Bax in vitro and in vivo to regulate lens differentiation. PMID: 22280356
Despite being overexpressed, the molecular properties of alpha-crystallins are disrupted by diabetes and contribute to the loss of neuroprotective function. PMID: 21467180
these findings show that mutation of alphaA-crystallin induces activation of the UPR during cataract formation. PMID: 20833134
Hydroimidazolone modification of human alphaA-crystallin: Effect on the chaperone function and protein refolding ability. PMID: 20085807
Methionine oxidation of alpha-crystallin in combination with loss of MsrA repair causes loss of alpha-crystallin chaperone function. PMID: 19733220
alphaA expression in vivo protects against cell death during mitosis in the lens epithelium PMID: 12584250
mouse lens epithelial cell progression through the cell cycle is significantly affected by expression of alphaA and alphaB-crystallin PMID: 15543941
tissue-specific expression of alphaA-crystallin is regulated by recruitment of Pax6 and c-Maf PMID: 16023139
Alpha-crystallin plays a role in suppressing caspase activity, resulting in retention of lens fiber cell integrity following degradation of mitochondria and other organelles during the apoptosis-like pathway of lens cell terminal differentiation. PMID: 16439475
The role of Cryab AND Cryaa in microtubule assembly is reported. PMID: 16675842
Data suggest that moderate level of alphaA-crystallin gene expression in lens epithelial cells does not require the presence of CBP and p300 in the promoter. PMID: 17467007
alphaA-crystallin regulates epithelial sodium channel expression PMID: 17664274
Tau expression increases in the alpha-crystallin knockout lenses, suggesting that alphaA- and alphaB-crystallins are potentially important regulators of tau expression in lens. PMID: 17893660
A modified genomic fragment of 15-kilobase Cryaa/enhanced green fluorescent protein (EGFP) is sufficient to direct the earliest onset of alphaA-crystallin/EGFP expression in the lens pit. PMID: 18803847
Decreased gene expression of Cryaa and Cryab in the lens is associated with the development of cataract in OXYS rats. PMID: 19120020
expression of R49C CRYAA mutant protein in the presence of the neor gene causes posterior cataracts with posterior migration of epithelial cell nuclei, and demonstrates that the mutant protein affects the integrity of lens fiber cells in the deep cortex. PMID: 19619312

Hide All

Subcellular Location

Cytoplasm. Nucleus.

Protein Families

Small heat shock protein (HSP20) family

Database Links

KEGG: mmu:12954

STRING: 10090.ENSMUSP00000019192

UniGene: Mm.1228

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP006007MO
Abbreviation	Recombinant Mouse Cryaa protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Alpha-crystallin A chain (Cryaa)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage