Recombinant Mouse Baculoviral IAP repeat-containing protein 5(Birc5)

Code CSB-EP002706MO
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Birc5
Uniprot No. O70201
Research Area Others
Alternative Names Birc5; Api4; Iap4Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin; TIAP
Species Mus musculus (Mouse)
Source E.coli
Expression Region 1-140aa
Target Protein Sequence MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 32.3kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. Involved in the recruitment of CPC to centromeres during early mitosis via association with histone H3 phosphorylated at 'Thr-3' (H3pT3) during mitosis. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7.
Gene References into Functions
  1. The present results indicated that PPARgamma may serve a protective role on bEnd.3 cells and that BIRC5 may be a downstream target of PPARgamma regulation during cerebral ischemia. PMID: 29039513
  2. While induced by exposure to reactive oxygen species generating stresses, the ultimate expression of changes in radiation response is dependent upon the bi-functionality of the tumor associated protein survivin and its intracellular translocation. PMID: 27427516
  3. HDL-associated sphingosine 1-phosphate inhibits macrophage apoptosis by stimulating STAT3 activity and survivin expression. PMID: 28038379
  4. Survivin also attenuates DNA damage related to PARP activation and inhibits TNFalpha-induced lipolysis, suggesting that Survivin may facilitate adipocyte maintenance in response to inflammatory stimuli. PMID: 28055005
  5. The study assigns a new meiotic function to Cullin9 and reveals that it prevents mouse eggs from aneuploidy by regulating microtubule dynamics via survivin. PMID: 27678504
  6. this study shows that that sorafenib promotes the survival of bone marrow cells by up-regulating survivin PMID: 27440860
  7. Survivin was regulated by TGF-beta and was found to be highly expressed during mucosal healing following intestinal inflammation PMID: 27715398
  8. SurvivinT34A combined with arsenic trioxide induces a loss of mitochondria membrane potential PMID: 27748945
  9. Survivin is a key regulator of gut tissue integrity by regulating epithelial homeostasis in the stem cell niche. PMID: 26832409
  10. TGFbetaRI inhibition in an injured adult heart could both stimulate the autocrine/paracrine activity of survivin and inhibit Wnt in CPCs to mediate cardioprotection and improve cardiac function. PMID: 26418219
  11. Survivin is a key gene for regulating squamous cell carcinoma (SCC) cancer stem cell formation and cancer SCC development. PMID: 26771605
  12. In colorectal cancer mice with downregulated expression of survivin, there were higher numbers of apoptotic cells and decreased expression levels of bcl2 and ki67. PMID: 26722528
  13. survivin is essential for B cell division but does not affect survival of naive B cells. Survival of proliferating B cells may be impacted indirectly by survivin deficiency because of increased genotoxic stress caused by failed chromosomal segregation. PMID: 26810226
  14. Survivin directly participates in PRL-mediated beta cell proliferation via Akt, STAT5-PIM and ERK signalling pathways during pregnancy PMID: 26099856
  15. Studied competitive inhibition of survivin using a cell-permeable recombinant protein induces cancer-specific apoptosis in colon cancer model. PMID: 25678789
  16. Results suggest a role for survivin in regulating adult neural precursor activity and inhibiting apoptosis or programmed cell death in the dentate gyrus following brain injury PMID: 25987205
  17. NR4A1 protects pancreatic beta-cells against endoplasmic reticulum stress-mediated apoptosis by up-regulating Survivin expression and down-regulating CHOP expression. PMID: 26157144
  18. Studies indicate the importance of survivin in Sonic hedgehog (SHH)-driven medulloblastoma (MB). PMID: 25241898
  19. the Skp1.Cul1.F-box protein complex subunit Fbxl7 modulates mitochondrial function by controlling the cellular abundance of survivin PMID: 25778398
  20. Both HIF1-alpha and survivin are involved in the retinal neovascularization in oxygen-induced retinopathy. PMID: 25400763
  21. survivin-mediated radio-adaptive response is dependent upon the ability of cells to activate NFkappaB PMID: 25763931
  22. These findings provide evidence for the existance of a posititve feedback loop connecting survivin expression in tumor cells to PI3K/Akt enhanced beta-catenin-Tcf/Lef-dependent transcription followed by secretion of VEGF and angiogenesis. PMID: 25204429
  23. Survivin has an important role in regulating folliculogenesis and oogenesis in the adult mouse ovary. PMID: 24675472
  24. Survivin partially regulates HSC function by modulating the Evi-1 transcription factor and its downstream targets PMID: 24903482
  25. The study shows that the inhibition of survivin is sufficient to reduce joint inflammation and bone damage in preclinical models of arthritis PMID: 25381389
  26. Survivin haploinsufficiency in syngeneic grafts was associated with Ischemia/reperfusion tissue injury, which triggered inflammation eventually resulting in graft loss. PMID: 24731002
  27. UHRF1 is strongly up-regulated during liver regeneration independently of BIRC5. PMID: 24818710
  28. Findings support the importance of adhesion molecules (VE-cadherin and CD31), survivin, and Ajuba in modulating the Hippo pathway, which regulates, in part, proliferation and survival in hemangioendotheliomas. PMID: 25266662
  29. Survivin may be an essential mediator of cyto-protection in podocytes injury. PMID: 24747598
  30. The survivin cascade in neural progenitor cells plays a role in anti-apoptosis. PMID: 24022164
  31. Data suggest that toll-like receptor 3 (TLR3), phosphatidylinositol 3-kinase (PI3K), survivin, Fas ligand (FasL), and CD95 (Fas) genes are involved in the development of cervical cancer. PMID: 25106857
  32. A 3M-CUL9-survivin pathway is implicated in maintaining microtubule and genome integrity, normal development, and tumor suppression. PMID: 24793696
  33. Data indicate that loss of survivin in conditional Pten deletion mouse model delays prostate tumor progression. PMID: 23936028
  34. The present studies aim to examine whether and how cilia function (Pkd1 or Pkd2) and structure (Tg737) play a role in cystic kidney and aneurysm through survivin downregulation. PMID: 24235270
  35. Increased expression of survivin correlates with the proliferation of neural stem cells in the DG of the hippocampus soon after traumatic brain injury. PMID: 23900556
  36. STAT3 phosphorylation and subsequent upregulation of survivin expression mediated by Notch-2 signaling in renal proximal tubule epithelial cells aid in the functional and structural recovery of the kidney from acute kidney injury. PMID: 23949800
  37. sticky siRNAs against survivin and cyclin B1 efficiently blocks growth of established subcutaneaous B16-F10 tumors as well as formation and dissemination of melanoma lung metastases. PMID: 23835136
  38. Data suggest survivin is a key mediator of cytoprotection in acute lung injury (as seen in antineoplastic-induced pulmonary fibrosis); survivin appears to act at epithelial/mucosal cell level; survivin action depends partly on apoptosis inhibition. PMID: 23979427
  39. Data from Pak1 knockout mice and RNA interference in cells suggest Pak1 has role in regulation of survivin ubiquitination/stability in beta-cells; impaired proliferation of beta-cells induced by loss of PAK1 is restored by overexpression of survivin. PMID: 23514967
  40. survivin inhibition/down-regulation with flavopiridol or specific shRNAs increased the apoptotic response of old fibroblasts to various genotoxic agents PMID: 22252435
  41. These results suggest that OX40 costimulation crucially engages survivin during antigen-mediated Th2 responses PMID: 23616302
  42. Thimerosal induces S phase arrest and finally causes apoptosis via inhibition of PI3K/Akt/survivin signaling. PMID: 23145070
  43. vaccination with recombinant Fowlpox expressing survivin improves T-cell responses against aggressive Malignant mesothelioma tumors and may form the basis for promising clinical applications. PMID: 23335100
  44. Our data support a function of survivin in hippocampal synaptic plasticity and learning and underline the importance of adult brain neurogenesis for proper operation of the hippocampal tri-synaptic circuit and the physiological functions that depend on it PMID: 23123921
  45. This study identified a novel role for survivin in erythroblast enucleation through previously unknown protein partners. PMID: 22491741
  46. overexpression of Bmi1 induces repressive epigenetic regulation of the promoter of Survivin, a well-characterized antiapoptotic protein. PMID: 23132836
  47. prepared two mutant forms of the PhSurv-PhTERT tandem with two or four Sp1 sites removed from the distal "long" PhSurv promoter PMID: 23056318
  48. Survivin prevents apoptosis by binding to caspase-3 in astrocytes infected with the BeAn strain of Theiler's murine encephalomyelitis virus. PMID: 22638909
  49. these data suggest a potentially novel role for survivin in functionally promoting astrocytic proliferation after intracerebral hemorrhage PMID: 22862734
  50. Survivin is a dual regulator of lens epithelial cell proliferation and lens fiber cell differentiation. PMID: 23213276
  51. A novel Sox2/survivin pathway that regulates neural stem cells survival and homoeostasis, thus revealing a new mechanism of brain development, neurological degeneration and such aging-related disorders. PMID: 23301561
  52. Expression of survivin is a downstream event of Flt3 signaling. PMID: 23082191
  53. survivin is essential for beta-cell mass expansion after PDL. Survivin appears to exhibit a preferential requirement for proliferation of preexisting beta cells. PMID: 22870272
  54. Surv(-/-) mice exhibit severe global conduction attenuations in atrial and ventricular myocardium as well as the specific conduction system, accompanied by lower connexin43 levels. PMID: 22976005
  55. Liver cancer initiation is controlled by AP-1 through SIRT6-dependent inhibition of survivin. PMID: 23041974
  56. UV-B induces cytoplasmic survivin expression in mouse epidermis PMID: 22748311
  57. Data show that tea polyphenols possibly downregulates the expression of nuclear factor kappa-light-chain-enhancer of activated B cells (NF-kappaB), cyclooxygenase-2 (COX-2) and Survivin in tumor tissue, thereby playing important roles in anti-angiogenesis. PMID: 22613332
  58. HDAC6 deacetylates survivin to regulate its nuclear export PMID: 22334690
  59. these results showed that the localization of Plk1 to kinetochores required the involvement of Survivin. PMID: 22554510
  60. Results indicate that tumor regression induced by YM155 is accompanied by down-regulation of intratumoral survivin, cell growth inhibition and induction of apoptosis. PMID: 21237508
  61. Developmental control of apoptosis by the immunophilin aryl hydrocarbon receptor-interacting protein (AIP) involves mitochondrial import of the survivin protein PMID: 21454573
  62. Paclitaxel can enhance the radiosensitivity of xenotransplanted nasopharyngeal carcinoma and its mechanism may rely on the down-regulation of Survivin expression. PMID: 20030047
  63. Findings delineate a new role of the IFN-gamma signaling pathway in regulating T cell proliferation and apoptosis through upregulating survivin and ifi202 expression. PMID: 21124930
  64. Polo-like kinase 1 contributes to the tumorigenicity of hepatoma cells via regulation of Survivin expression PMID: 21330050
  65. Results define a novel mechanism of survivin regulation by EGF through the Raf-1/MEK/ERK pathway in pancreatic beta-cells, via prolongation of survivin protein half-life and inhibition of the ubiquitin-mediated proteasomal degradation pathway. PMID: 20807437
  66. survivin expression overlaps with stem cell markers in various pathophysiological processes PMID: 20133811
  67. survivin was clearly observed on regions of microtubule attachment to chromosomes throughout endomitosis of murine MKs, but seldom localized to midzone microtubule spindles of high-ploidy MKs PMID: 20864587
  68. nuclear factor-kappaB activation and survivin expression are inhibited by PSK in combination with docetaxel in gastric neoplasms PMID: 20126979
  69. A mutant amino acid motif of survivin (SurR9-C84A) can bind to microtubules and regulate their stability, induce cell division, increase proliferation in human neuroblastoma cells. PMID: 20709413
  70. Results indicate that reactivation of the antiapoptotic Survivin may be a critical step in JCV T-antigen-induced transformation, which in neural progenitors requires IGF-IR. PMID: 19834489
  71. results suggest that AMPKalpha1, but not AMPKalpha2 activation, promotes cell survival by increasing NF-kappaB-mediated expression of anti-apoptotic proteins (Bcl-2 and Survivin) and intracellular ATP contents PMID: 20233722
  72. The findings highlight the critical role that survivin plays during neural development, deficiencies of which dramatically impact on postnatal neural function. PMID: 20051123
  73. Runx2 (runt-related transcription factor 2) regulates survivin expression in prostate cancer cells PMID: 19949374
  74. survivin has a role in preventing sensitization of Lewis Lung Carcinoma cells to radiation efficiently PMID: 19956869
  75. increasing the B[a]P suppressed p53 and Bax, while decreasing the expression of Bcl-2 and Survivin. PMID: 19629484
  76. Demonstration of nuclear-localized survivin protein in presumptive ductal and proacinar lumen-bounding cells suggests that survivin may be a key mediator of embryonic submandibular salivary gland epithelial cell survival. PMID: 11305929
  77. survivin is a critical regulator of SMC apoptosis after acute vascular injury. PMID: 12172543
  78. survivin is dramatically expressed in a cell cycle-dependent manner during liver regeneration and provides a new insight into the regulation of cell proliferation and differentiation. PMID: 12220508
  79. An antiapoptosis protein; is associated with cell cycle entry of normal cord blood CD34(+) cells and modulates cell cycle and proliferation of mouse hematopoietic progenitor cells PMID: 12239157
  80. Survivin expression in mouse skin prevents papilloma regression and promotes chemical-induced tumor progression. PMID: 12566297
  81. survivin is an essential antiapoptotic gene expressed in preimplantation embryos and could protect the embryos from apoptosis by inhibiting an apoptotic pathway involving caspases PMID: 12679106
  82. Data show that mammalian cells lacking survivin are unable to align their chromosomes, fail to recruit Aurora B to kinetochores and become polyploid at a very high frequency. PMID: 12805209
  83. Extent of vascularization of the infarct is dependent on expression of survivin. PMID: 12937134
  84. the survivin-p21 axis plays an important role in the proliferation of normal hematopoietic cells PMID: 12969960
  85. Survivin is not essential for T cell apoptosis but is crucial for T cell maturation and proliferation. PMID: 14699085
  86. survivin is not detected at any stage of the megakaryocyte endomitotic cell cycle, and in most megakaryocytes proteasome inhibition does not rescue this phenotype PMID: 14751927
  87. survivin plays a critical role in early thymocyte development. PMID: 14757745
  88. new insights into the regulation and function of survivin and implications for the pathogenesis, diagnosis, and treatment of inflammatory diseases and cancer PMID: 15148334
  89. Cdh5 expression and clustering maintain low levels of survivin in endothelial cells. PMID: 15215174
  90. Combination of radiotherapy and inhibition of survivin and XIAP through the antisense approach results in improved tumor control by radiotherapy in a mouse model of lung cancer. PMID: 15258565
  91. survivin is regulated by the RB/E2F family of proteins PMID: 15271987
  92. results indicate that CA-Ras modulates Survivin expression independent of hematopoietic growth factors and that a CA-Ras/Survivin axis regulates survival and proliferation of transformed hematopoietic cells PMID: 15369798
  93. involvement of Survivin (and the associated events) in UV-B response in vitro and in vivo in experimental models regarded to have relevance to human situations PMID: 15623349
  94. Survivin is controlled in peripheral T cells by OX40 cosignaling via sustained PI3k and PKB activation. PMID: 15894279
  95. findings support a role for survivin in rhabdomyosarcoma biology PMID: 15908567
  96. role for survivin as an antiapoptotic protein during normal neuronal development PMID: 16049172
  97. TGF-alpha inhibits apoptosis in mouse blastocysts through upregulation of survivin expression PMID: 16079309
  98. transgenic mice expressing survivin in pancreatic islet beta-cells show no changes in cell proliferation, as determined by islet size or islet number PMID: 16470228
  99. AS101decreased expression of the inhibitor of apoptosis, survivin in mouse myleoma cell in vitro. PMID: 16889755
  100. The dynamic intracellular localization of survivin(140) is mediated by a Crm1-dependent nuclear export signal present also in survivin(121), but absent in survivin(40). PMID: 16984408

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus, Chromosome, Chromosome, centromere, Cytoplasm, cytoskeleton, spindle, Chromosome, centromere, kinetochore, Midbody
Protein Families IAP family
Database Links

KEGG: mmu:11799

STRING: 10090.ENSMUSP00000079124

UniGene: Mm.8552

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1