| Code | CSB-EP002683MO | 
| Abbreviation | Recombinant Mouse Bgn protein | 
| MSDS | |
| Size | US$306 | 
| Order now | |
| Image | 
 | 
| Have Questions? | Leave a Message or Start an on-line Chat | 
The region for expressing recombinant Mouse Bgn contains amino acids 38-369. This Bgn protein is theoretically predicted to have a molecular weight of 43.4 kDa. This protein is generated in a e.coli-based system. The N-terminal 10xHis tag was fused into the coding gene segment of Bgn, making it easier to detect and purify the Bgn recombinant protein in the later stages of expression and purification.
Biglycan (Bgn) is an important protein with research covering biomedicine, biochemistry, and tissue engineering. In the field of skeletal biology, Biglycan plays a pivotal role in bone formation and maintenance, with particular attention to studies related to bone density and osteoporosis. Additionally, Biglycan is a significant extracellular matrix protein involved in the formation and regulation of connective tissues, playing a vital role in maintaining tissue structure and function. In cardiovascular disease research, Biglycan has been found to participate in pathological processes such as atherosclerosis, making it a potential therapeutic target for cardiovascular diseases. Moreover, Biglycan is implicated in physiological processes like inflammatory responses and immune regulation.There are currently no reviews for this product.
I have plan to buy protein (which is CSB-EP002683MO and CSB-EP20246MO).
let me know the information.
Thesse product is mature protein.
Dose in contain signal peptide ?
Your protien contain only mature sequcnce of protein?
Thanks you so much.
DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
YKLVCYFTSWSQYREGVGSFLPDAIQPFLCTHIIYSFANISSDNMLSTWEWNDESNYDKLNKLKTRNTNLKTLLSVGGWKFGEKRFSEIASNTERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLRDKQYFSTLIKELNAEFTKEVQPGREKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGVWRQITGHHSPLFQGQKDTRFDRYSNVNYAVQYMIRLGAQASKLLMGIPTFGKSFTLASSENQLGAPISGEGLPGRFTKEAGTLAYYEICDFLKGAEVHRLSNEKVPFATKGNQWVGYEDKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTNAIKDALA