Recombinant Mouse Biglycan (Bgn)

In Stock
Code CSB-EP002683MO
Abbreviation Recombinant Mouse Bgn protein
MSDS
Size US$306
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002683MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002683MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Bgn; Biglycan; Bone/cartilage proteoglycan I; PG-S1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
38-369aa
Target Protein Sequence
DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Mouse Bgn contains amino acids 38-369. This Bgn protein is theoretically predicted to have a molecular weight of 43.4 kDa. This protein is generated in a e.coli-based system. The N-terminal 10xHis tag was fused into the coding gene segment of Bgn, making it easier to detect and purify the Bgn recombinant protein in the later stages of expression and purification.

Biglycan (Bgn) is an important protein with research covering biomedicine, biochemistry, and tissue engineering. In the field of skeletal biology, Biglycan plays a pivotal role in bone formation and maintenance, with particular attention to studies related to bone density and osteoporosis. Additionally, Biglycan is a significant extracellular matrix protein involved in the formation and regulation of connective tissues, playing a vital role in maintaining tissue structure and function. In cardiovascular disease research, Biglycan has been found to participate in pathological processes such as atherosclerosis, making it a potential therapeutic target for cardiovascular diseases. Moreover, Biglycan is implicated in physiological processes like inflammatory responses and immune regulation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I have plan to buy protein (which is CSB-EP002683MO and CSB-EP20246MO).
let me know the information.
Thesse product is mature protein.
Dose in contain signal peptide ?
Your protien contain only mature sequcnce of protein?
Thanks you so much.

A:
Thanks for your inquiry.
1. Recombinant Mouse Biglycan(Bgn)
CSB-EP002683MO >> E.coli
Lead time:
Expression Region: 38-369aa; Full length of the mature protein.
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein Sequence:(Not include the tag sequence and signal peptide sequence)

DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK


2.Recombinant Mouse Chitinase-3-like protein 1(Chi3l1)
CSB-EP720246MO >> E.coli
Lead time:
Expression Region: 30-389aa; Full length of the mature protein.
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein Sequence:(Not include the tag sequence and signal peptide sequence)

YKLVCYFTSWSQYREGVGSFLPDAIQPFLCTHIIYSFANISSDNMLSTWEWNDESNYDKLNKLKTRNTNLKTLLSVGGWKFGEKRFSEIASNTERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLRDKQYFSTLIKELNAEFTKEVQPGREKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGVWRQITGHHSPLFQGQKDTRFDRYSNVNYAVQYMIRLGAQASKLLMGIPTFGKSFTLASSENQLGAPISGEGLPGRFTKEAGTLAYYEICDFLKGAEVHRLSNEKVPFATKGNQWVGYEDKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTNAIKDALA


Yes, for these two proteins, what we provide is the full length of the mature protein, not include the signal peptide,
In general, the strong hydrophobicity of the signal peptide will increase the difficulty of expression.
At the same time, the signal peptide will be cut off by the signal peptidase in the process of secretion expression.
The mature protein does not contain the signal peptide, and the functions for most of the protein are realized through the mature protein.
PS: If you need to express the proteins with the full sequence including the signal peptide, we can also try to express them for you, but the prices will be higher.

Target Background

Function
May be involved in collagen fiber assembly.
Gene References into Functions
  1. Knockout results provide evidence that decorin and biglycan are necessary for maintaining collagen fibril structure, fiber realignment, and mechanical properties of mature tendons. PMID: 28882761
  2. A novel biological pathway has been discovered of soluble biglycan inducing HIF-2alpha protein stabilization and Epo production presumably in an oxygen-independent manner, ultimately giving rise to secondary polycythemia. PMID: 27600268
  3. Results show that Bgn plays a role in the process of angiogenesis during fracture healing, and that effect appears to be partially mediated through endostatin suppression. PMID: 27072616
  4. Asporin deficiency changes skin glycosaminoglycan composition, and decorin and biglycan content, which may explain the changes in skin mechanical properties. PMID: 28859141
  5. Biglycan plays a protective role during the progression of atherosclerosis in ApoE-deficient mice by inhibiting thrombin generation. PMID: 27034473
  6. These genes were concordantly induced by TAC in WT but not in biglycan KO mice. CONCLUSIONS: Left ventricular pressure overload induces biglycan expression in cardiac fibroblasts. Ablation of biglycan improves cardiac function and attenuates left ventricular hypertrophy and fibrosis after long-term pressure overload. PMID: 27789290
  7. Importance of biglycan and decorin as targets for the manipulation of fetal membrane extracellular matrix stability in the context of inflammation. PMID: 25914258
  8. Biglycan deficiency leads to loosely packed aortic collagen fibers, increased susceptibility of aortic elastin fibers to angII-induced stress, and up-regulation of vascular perlecan content. PMID: 25093698
  9. Biglycan signaling supported fetal membrane remodeling during early gestation in the absence of concomitant changes in TGFbeta levels. PMID: 24373743
  10. Lumican and biglycan influence corneal keratocyte lamellipodia organization and are critical in the regulation of stromal collagen fibrillogenesis. PMID: 24447998
  11. Biglycan-triggered TLR-2- and TLR-4-signaling exacerbates the pathophysiology of ischemic acute kidney injury. PMID: 24480070
  12. De novo expression of circulating biglycan evokes an innate inflammatory tissue response via MyD88/TRIF pathways. PMID: 24361484
  13. Early stage patellar tendon healing was inferior in biglycan-null and decorin-null mice as compared to wild type. PMID: 24157578
  14. This suggests that biglycan and decorin may have sequential roles in the tendon response to injury. PMID: 24072490
  15. Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation. PMID: 24257755
  16. extracellular matrix biglycan mediates breast cancer normalization induced by embryonic mesenchyme PMID: 23817524
  17. Biglycan plays a role in tendon viscoelasticity that cannot be completely explained by its role in collagen fibrillogenesis. PMID: 23592048
  18. Biglycan deletion alters adiponectin expression in murine adipose tissue and 3T3-L1 adipocytes. PMID: 23189205
  19. The glycosaminoglycans chains of biglycan (BGN) promote BGN-assisted BMP-4 function. PMID: 22895561
  20. Bgn inhibits the major properties of HER-2/neu-transformed cells, which is inversely modulated by the PKC signaling cascade. PMID: 22582394
  21. Increased messenger RNA (mRNA) expression of extracellular matrix genes BGN and COL1A1 was observed in the mouse epididymal adipose tissue after high-fat diet. PMID: 21775118
  22. Biglycan/decorin mixed double knockout mouse is a model of dystocia and delayed labor onset. PMID: 22253749
  23. Extracellular matrix protein biglycan plays a novel role in regulating synapse stability. PMID: 22396407
  24. Use of a transplant system and a fracture healing model revealed that expression of Wnt-induced secreted protein 1 was decreased in bone formed by biglycan-deficient cells, further suggesting reduced Wnt signaling in vivo. PMID: 21969569
  25. Biglycan is expressed/developmentally regulated in placenta and fetal membranes; data from mutant mouse strains suggest that both biglycan and decorin contribute to gestational success (i.e., prevent premature birth). PMID: 21502335
  26. critical for temporomandibular joint subchondral bone integrity PMID: 21917603
  27. Biglycan and decorin reduced the proliferation of pre-adipocytes, partly by induction of apoptosis. Furthermore, the anti-proliferative capabilities of decorin and biglycan were nullified with removal of GAG side-chains. PMID: 21702857
  28. bgn deficiency promotes myofibroblast differentiation and proliferation in vitro and in vivo likely due to increased responses to TGF-beta and SMAD2 signaling PMID: 21454527
  29. Biglycan and fibromodulin are novel key players in regulating chondrogenesis and extracellular matrix turnover during temoporomandibular joint osteoarthritis pathology. PMID: 20035055
  30. Biglycan deficiency significantly accelerated disc degeneration in mice. PMID: 19940720
  31. Beta1 integrin and htis protein's binding sites are localized to different laminin-G-domain-like (LG) modules within the laminin alpha5 chain G domain. PMID: 12519075
  32. decorin and biglycan play distinct roles in palatogenesis, and decorin was more actively involved in the process of secondary palate formation than biglycan. PMID: 12666199
  33. biglycan deficient mice have diminished capacity to produce marrow stromal cells, the bone cell precursors, and this deficiency increases with age PMID: 12975603
  34. Deficiency protects against increased trabecular bone turnover and bone loss in response to estrogen depletion. PMID: 14672350
  35. bgn is required for retaining an appropriate microenvironment for the maturation of osteoblastic stem cells PMID: 15173106
  36. In addition to the imbalance between differentiation and proliferation, there was a differential decrease in secretory leukocyte protease inhibitor (slpi) in bgn deficient osteoblasts treated with 1,25-(OH)(2)D(3) PMID: 16364709
  37. biglycan is important for the maintenance of muscle cell integrity and plays a direct role in regulating the expression and sarcolemmal localization of the intracellular signaling proteins dystrobrevin-1 and -2, alpha- and beta1-syntrophin and nNOS PMID: 16807372
  38. biglycan has a particularly important function during muscle and connective tissue development PMID: 16810681
  39. Biglycan is a ligand for two members of the sarcoglycan complex and regulates their expression at discrete developmental ages. PMID: 16883602
  40. Biglycan is a positive modulator of BMP-2 induced osteoblast differentiation PMID: 17120779
  41. At embryonic day 18.5, alizarin red/alcian blue staining showed that the Bgn/Dcn double deficient mice had hypomineralization of the frontal and parietal craniofacial bones. PMID: 17188951
  42. death of biglycan-deficient mice from aortic rupture implicates biglycan as essential for the structural and functional integrity of the aortic wall and implicates biglycan gene defects in the pathogenesis of aortic dissection and rupture PMID: 17502576
  43. These preliminary data suggest that WISP-1 and BGN may functionally interact and control each other's activity, thus regulating the differentiation and proliferation of osteogenic cells. PMID: 18701807
  44. Biglycan overexpression did not significantly affect the amelogenin expression in incisor and molar teeth in 3-day postnatal transgenic mice. PMID: 18727043
  45. decorin has a primary role in regulating fibril assembly, a function that can be fine-tuned by biglycan during early development. PMID: 19136671
  46. Findings indicate that normal expression of small leucine rich proteoglycans, such as biglycan and decorin, plays an important role in the highly orchestrated process of dentin mineralization. PMID: 19379665
  47. By signaling through TLR2/4, biglycan stimulates the expression of NLRP3 and pro-IL-1beta mRNA. PMID: 19605353
  48. Binds to the carboxyl-terminal third of the alpha-dystroglycan core polypeptide. This interaction requires the chondroitin sulfate side chains of biglycan. PMID: 10684260

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Tissue Specificity
Found in several connective tissues, especially in articular cartilages.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*