Name: Recombinant Mouse Biglycan (Bgn)
Brand: CUSABIO
SKU: CSB-EP002683MO

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Bgn

Uniprot No.

P28653

Research Area

Signal Transduction

Alternative Names

Bgn; Biglycan; Bone/cartilage proteoglycan I; PG-S1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

38-369aa

Target Protein Sequence

DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

43.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Mouse Bgn contains amino acids 38-369. This Bgn protein is theoretically predicted to have a molecular weight of 43.4 kDa. This protein is generated in a e.coli-based system. The N-terminal 10xHis tag was fused into the coding gene segment of Bgn, making it easier to detect and purify the Bgn recombinant protein in the later stages of expression and purification.

Biglycan (Bgn) is an important protein with research covering biomedicine, biochemistry, and tissue engineering. In the field of skeletal biology, Biglycan plays a pivotal role in bone formation and maintenance, with particular attention to studies related to bone density and osteoporosis. Additionally, Biglycan is a significant extracellular matrix protein involved in the formation and regulation of connective tissues, playing a vital role in maintaining tissue structure and function. In cardiovascular disease research, Biglycan has been found to participate in pathological processes such as atherosclerosis, making it a potential therapeutic target for cardiovascular diseases. Moreover, Biglycan is implicated in physiological processes like inflammatory responses and immune regulation.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I have plan to buy protein (which is CSB-EP002683MO and CSB-EP20246MO).
let me know the information.
Thesse product is mature protein.
Dose in contain signal peptide ?
Your protien contain only mature sequcnce of protein?
Thanks you so much.

Thanks for your inquiry.
1. Recombinant Mouse Biglycan(Bgn)
CSB-EP002683MO >> E.coli
Lead time:
Expression Region: 38-369aa; Full length of the mature protein.
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein Sequence:(Not include the tag sequence and signal peptide sequence)

2.Recombinant Mouse Chitinase-3-like protein 1(Chi3l1)
CSB-EP720246MO >> E.coli
Lead time:
Expression Region: 30-389aa; Full length of the mature protein.
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein Sequence:(Not include the tag sequence and signal peptide sequence)

YKLVCYFTSWSQYREGVGSFLPDAIQPFLCTHIIYSFANISSDNMLSTWEWNDESNYDKLNKLKTRNTNLKTLLSVGGWKFGEKRFSEIASNTERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLRDKQYFSTLIKELNAEFTKEVQPGREKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGVWRQITGHHSPLFQGQKDTRFDRYSNVNYAVQYMIRLGAQASKLLMGIPTFGKSFTLASSENQLGAPISGEGLPGRFTKEAGTLAYYEICDFLKGAEVHRLSNEKVPFATKGNQWVGYEDKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTNAIKDALA

Yes, for these two proteins, what we provide is the full length of the mature protein, not include the signal peptide,
In general, the strong hydrophobicity of the signal peptide will increase the difficulty of expression.
At the same time, the signal peptide will be cut off by the signal peptidase in the process of secretion expression.
The mature protein does not contain the signal peptide, and the functions for most of the protein are realized through the mature protein.
PS: If you need to express the proteins with the full sequence including the signal peptide, we can also try to express them for you, but the prices will be higher.

Target Background

Function

May be involved in collagen fiber assembly.

Gene References into Functions

Knockout results provide evidence that decorin and biglycan are necessary for maintaining collagen fibril structure, fiber realignment, and mechanical properties of mature tendons. PMID: 28882761
A novel biological pathway has been discovered of soluble biglycan inducing HIF-2alpha protein stabilization and Epo production presumably in an oxygen-independent manner, ultimately giving rise to secondary polycythemia. PMID: 27600268
Results show that Bgn plays a role in the process of angiogenesis during fracture healing, and that effect appears to be partially mediated through endostatin suppression. PMID: 27072616
Asporin deficiency changes skin glycosaminoglycan composition, and decorin and biglycan content, which may explain the changes in skin mechanical properties. PMID: 28859141
Biglycan plays a protective role during the progression of atherosclerosis in ApoE-deficient mice by inhibiting thrombin generation. PMID: 27034473
These genes were concordantly induced by TAC in WT but not in biglycan KO mice. CONCLUSIONS: Left ventricular pressure overload induces biglycan expression in cardiac fibroblasts. Ablation of biglycan improves cardiac function and attenuates left ventricular hypertrophy and fibrosis after long-term pressure overload. PMID: 27789290
Importance of biglycan and decorin as targets for the manipulation of fetal membrane extracellular matrix stability in the context of inflammation. PMID: 25914258
Biglycan deficiency leads to loosely packed aortic collagen fibers, increased susceptibility of aortic elastin fibers to angII-induced stress, and up-regulation of vascular perlecan content. PMID: 25093698
Biglycan signaling supported fetal membrane remodeling during early gestation in the absence of concomitant changes in TGFbeta levels. PMID: 24373743
Lumican and biglycan influence corneal keratocyte lamellipodia organization and are critical in the regulation of stromal collagen fibrillogenesis. PMID: 24447998
Biglycan-triggered TLR-2- and TLR-4-signaling exacerbates the pathophysiology of ischemic acute kidney injury. PMID: 24480070
De novo expression of circulating biglycan evokes an innate inflammatory tissue response via MyD88/TRIF pathways. PMID: 24361484
Early stage patellar tendon healing was inferior in biglycan-null and decorin-null mice as compared to wild type. PMID: 24157578
This suggests that biglycan and decorin may have sequential roles in the tendon response to injury. PMID: 24072490
Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation. PMID: 24257755
extracellular matrix biglycan mediates breast cancer normalization induced by embryonic mesenchyme PMID: 23817524
Biglycan plays a role in tendon viscoelasticity that cannot be completely explained by its role in collagen fibrillogenesis. PMID: 23592048
Biglycan deletion alters adiponectin expression in murine adipose tissue and 3T3-L1 adipocytes. PMID: 23189205
The glycosaminoglycans chains of biglycan (BGN) promote BGN-assisted BMP-4 function. PMID: 22895561
Bgn inhibits the major properties of HER-2/neu-transformed cells, which is inversely modulated by the PKC signaling cascade. PMID: 22582394
Increased messenger RNA (mRNA) expression of extracellular matrix genes BGN and COL1A1 was observed in the mouse epididymal adipose tissue after high-fat diet. PMID: 21775118
Biglycan/decorin mixed double knockout mouse is a model of dystocia and delayed labor onset. PMID: 22253749
Extracellular matrix protein biglycan plays a novel role in regulating synapse stability. PMID: 22396407
Use of a transplant system and a fracture healing model revealed that expression of Wnt-induced secreted protein 1 was decreased in bone formed by biglycan-deficient cells, further suggesting reduced Wnt signaling in vivo. PMID: 21969569
Biglycan is expressed/developmentally regulated in placenta and fetal membranes; data from mutant mouse strains suggest that both biglycan and decorin contribute to gestational success (i.e., prevent premature birth). PMID: 21502335
critical for temporomandibular joint subchondral bone integrity PMID: 21917603
Biglycan and decorin reduced the proliferation of pre-adipocytes, partly by induction of apoptosis. Furthermore, the anti-proliferative capabilities of decorin and biglycan were nullified with removal of GAG side-chains. PMID: 21702857
bgn deficiency promotes myofibroblast differentiation and proliferation in vitro and in vivo likely due to increased responses to TGF-beta and SMAD2 signaling PMID: 21454527
Biglycan and fibromodulin are novel key players in regulating chondrogenesis and extracellular matrix turnover during temoporomandibular joint osteoarthritis pathology. PMID: 20035055
Biglycan deficiency significantly accelerated disc degeneration in mice. PMID: 19940720
Beta1 integrin and htis protein's binding sites are localized to different laminin-G-domain-like (LG) modules within the laminin alpha5 chain G domain. PMID: 12519075
decorin and biglycan play distinct roles in palatogenesis, and decorin was more actively involved in the process of secondary palate formation than biglycan. PMID: 12666199
biglycan deficient mice have diminished capacity to produce marrow stromal cells, the bone cell precursors, and this deficiency increases with age PMID: 12975603
Deficiency protects against increased trabecular bone turnover and bone loss in response to estrogen depletion. PMID: 14672350
bgn is required for retaining an appropriate microenvironment for the maturation of osteoblastic stem cells PMID: 15173106
In addition to the imbalance between differentiation and proliferation, there was a differential decrease in secretory leukocyte protease inhibitor (slpi) in bgn deficient osteoblasts treated with 1,25-(OH)(2)D(3) PMID: 16364709
biglycan is important for the maintenance of muscle cell integrity and plays a direct role in regulating the expression and sarcolemmal localization of the intracellular signaling proteins dystrobrevin-1 and -2, alpha- and beta1-syntrophin and nNOS PMID: 16807372
biglycan has a particularly important function during muscle and connective tissue development PMID: 16810681
Biglycan is a ligand for two members of the sarcoglycan complex and regulates their expression at discrete developmental ages. PMID: 16883602
Biglycan is a positive modulator of BMP-2 induced osteoblast differentiation PMID: 17120779
At embryonic day 18.5, alizarin red/alcian blue staining showed that the Bgn/Dcn double deficient mice had hypomineralization of the frontal and parietal craniofacial bones. PMID: 17188951
death of biglycan-deficient mice from aortic rupture implicates biglycan as essential for the structural and functional integrity of the aortic wall and implicates biglycan gene defects in the pathogenesis of aortic dissection and rupture PMID: 17502576
These preliminary data suggest that WISP-1 and BGN may functionally interact and control each other's activity, thus regulating the differentiation and proliferation of osteogenic cells. PMID: 18701807
Biglycan overexpression did not significantly affect the amelogenin expression in incisor and molar teeth in 3-day postnatal transgenic mice. PMID: 18727043
decorin has a primary role in regulating fibril assembly, a function that can be fine-tuned by biglycan during early development. PMID: 19136671
Findings indicate that normal expression of small leucine rich proteoglycans, such as biglycan and decorin, plays an important role in the highly orchestrated process of dentin mineralization. PMID: 19379665
By signaling through TLR2/4, biglycan stimulates the expression of NLRP3 and pro-IL-1beta mRNA. PMID: 19605353
Binds to the carboxyl-terminal third of the alpha-dystroglycan core polypeptide. This interaction requires the chondroitin sulfate side chains of biglycan. PMID: 10684260

Hide All

Subcellular Location

Secreted, extracellular space, extracellular matrix.

Protein Families

Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily

Tissue Specificity

Found in several connective tissues, especially in articular cartilages.

Database Links

KEGG: mmu:12111

STRING: 10090.ENSMUSP00000033741

UniGene: Mm.2608

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address