Home
Protein
Recombinant Proteins
Recombinant Mouse Brain-specific serine protease 4 (Prss22)

Recombinant Mouse Brain-specific serine protease 4 (Prss22)

^{In Stock}

Code	CSB-EP880636MO
Abbreviation	Recombinant Mouse Prss22 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Prss22

Uniprot No.

Q9ER10

Research Area

Cell Biology

Alternative Names

Prss22; Bssp4; Prss26Brain-specific serine protease 4; BSSP-4; EC 3.4.21.-; Serine protease 22; Serine protease 26; Tryptase epsilon

Species

Mus musculus(Mouse)

Source

E.coli

Expression Region

33-306aa

Target Protein Sequence

ATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCADDRPGVYTSLLAHRSWVQRIVQGVQLRGYLADSGDTGSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

35.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 33-306 constitute the expression domain of recombinant Mouse Prss22. The theoretical molecular weight of the Prss22 protein is 35.9 kDa. Expression of this Prss22 protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of Prss22, making it easier to detect and purify the Prss22 recombinant protein in the later stages of expression and purification.

The mouse brain-specific serine protease 4 (Bssp4), also known as Prss22, is an enzyme that belongs to the serine protease family and is primarily expressed in the brain. As a serine protease, Prss22 likely participates in the regulation of protein processing within neural tissues. Serine proteases, in general, are known for their involvement in various cellular functions, including synaptic plasticity, neuronal development, and modulation of signaling pathways.