Recombinant Mouse C-X-C motif chemokine 15 (Cxcl15)

In Stock Promotion
Code CSB-EP894386MO
Abbreviation Recombinant Mouse Cxcl15 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Cxcl15
Uniprot No.
Research Area
Immunology
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
26-167aa
Target Protein Sequence
QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions.
Gene References into Functions
  1. inflammation triggered property of Microcystin-LR via IL-8/CXCR2 signaling PMID: 29197248
  2. this study shows that ponciretin may attenuate ethanol-induced gastritis via the regulation of IL-8 secretion PMID: 28013186
  3. Adh binds to OR5M11, which enhances Actinobacillus pleuropneumoniae pathogenicity by activating p38 which induces apoptosis of PAMs and IL-8 release PMID: 27046446
  4. Findings suggest that IL8-dependent osteoclast activation may constitute an early event in the initiation of the joint specific inflammation in anti-citrullinated protein-positive rheumatoid arthritis. PMID: 26612338
  5. Data suggest that CXCL1/IL-8, released from osteoclasts in an autoantibody-dependent manner, produces pain by activating sensory neurons. PMID: 26613766
  6. IL-8 signaling is up-regulated in alcoholic hepatitis. PMID: 26260904
  7. expressions of IL-1beta and IL-8 in the brain increased after ApoE knockout in mice PMID: 25940280
  8. CYLD negatively regulates nontypeable Haemophilus influenzae-induced IL-8 expression via MKP-1-dependent inhibition of ERK. PMID: 25389768
  9. Taken together, these results indicate that CD147 promotes lung cancer-induced osteoclastogenesis by modulating IL-8 secretion, and suggest that CD147 is a potential therapeutic target for cancer-associated bone resorption in lung cancer patients. PMID: 25661002
  10. these data outline a novel role for the P2Y6 receptor in the induction of CXCL8/IL-8 production and barrier dysfunction in response to C. difficile toxin exposure and may provide a new therapeutic target for the treatment of CDI. PMID: 24278446
  11. these data suggest that IL-8 plays an important role in breast cancer osteolysis PMID: 24486955
  12. T. crispa ethanol extract fraction was used to investigate the potential immunomodulatory effect of different T. crispa doses ranging from 25 mug/mL to 1000 mug/mL on RAW 246.7 cells by detecting intracellular INF-gamma, IL-6, and IL-8 expressions. PMID: 24969238
  13. We found that IL-33 could induce and enhance the expression of IL-6 and IL-8 in PBMCs of COPD mice via p38 MAPK pathway. PMID: 24866242
  14. The hepatic expression of IL8 and LAMC2 has high sensitivity for biliary atresia at diagnosis and may serve as a biomarker of disease, with an important role for the IL8 signaling in experimental disease. PMID: 24493287
  15. These results suggest that increased IL-8 (mKC) levels may be involved in steroid-resistant neutrophilic airway inflammation through an NF-kappaB-dependent pathway. PMID: 23456484
  16. The HIF-1alpha/IL-8 signaling pathway plays a critical role in the protective effects of endothelial progenitor cells in the ischemic hind limb of diabetic mice. PMID: 23252631
  17. Changes in IL-8 expression level during development is related to its regulatory role in mouse mammary gland immunity. PMID: 23096912
  18. CagA may potentially interfere with TAK1 activity during NF-kB activation for IL-8 induction in early H. pylori infection PMID: 23409168
  19. These data suggest that IL-8 participates in the formation of cystic structures by Madin-Darby canine kidney cells in 3D culture and that HGF may stimulate tubulogenesis through the suppression of IL-8. PMID: 23485708
  20. ExoU activates NF-kappaB, stimulating IL-8 expression and secretion during P. aeruginosa infection PMID: 22848596
  21. Met signaling regulates the secretion of the pro-angiogenic chemokine interleukin-8/CXCL8 PMID: 22815748

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Tissue Specificity
Expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. Expressed at low levels in fetal lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*