Recombinant Mouse C-type lectin domain family 4 member A(Clec4a),partial

In Stock
Code CSB-EP874136MO
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Clec4a
Uniprot No. Q9QZ15
Research Area Immunology
Alternative Names Clec4a; Clec4a2; Clecsf6; DcirC-type lectin domain family 4 member A; C-type lectin superfamily member 6; Dendritic cell immunoreceptor; CD antigen CD367
Species Mus musculus (Mouse)
Source E.coli
Expression Region 70-238aa
Target Protein Sequence QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 39.6kDa
Protein Length Extracellular Domain
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.; C-type lectin receptor that binds carbohydrates mannose and fucose but also weakly interacts with N-acetylglucosamine (GlcNAc) in a Ca(2+)-dependent manner. Involved in regulating immune reactivity. Once triggered by antigen, it is internalized by clathrin-dependent endocytosis and delivers its antigenic cargo into the antigen presentation pathway resulting in cross-priming of CD8(+) T cells. This cross-presentation and cross-priming are enhanced by TLR7 and TLR8 agonists with increased expansion of the CD8(+) T cells, high production of IFNG and TNF with reduced levels of IL4, IL5 and IL13. In plasmacytoid dendritic cells, inhibits TLR9-mediated IFNA and TNF production. May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.
Gene References into Functions
  1. DCIR modulates immunity to M. tuberculosis through sustaining type I IFN signaling in DCs, which reduces IL-12-p70 production and Th1 expansion. As a consequence, DCIR-deficient mice control M. tuberculosis infection better than their WT counterparts but also develop more immunopathology in the lungs. PMID: 28069953
  2. this study shows that upon injection of d-galactosamine and lipopolysaccharide, Dcir1-/- mice show decreased mortality rates and serum levels of alanine aminotransferase PMID: 28127756
  3. Dcir1 enhances the pathogenesis of DSS colitis by altering neutrophil recruitment and their functions. PMID: 26497661
  4. While DCIR1 was ubiquitously expressed on myeloid cells in various immune organs, significant expression of DCAR2 was detected only on subpopulations of conventional dendritic cells from bone marrow and skin-draining lymph nodes. PMID: 26431873
  5. MCL-/- as well as DCIR-/- mice exhibited only a slightly increased severity of disease compared to wild-type mice indicating a limited role for MCL and DCIR in the regulation of intestinal immunity. PMID: 25068517
  6. our findings show that DCIR plays an important role in maintaining bone homeostasis. PMID: 25926676
  7. DCIR is a novel receptor for IVIg, mediating interaction of innate and adaptive immunity in tolerogenic responses. PMID: 24210883
  8. This study indicates that DCIR is critically involved in Cerebral malaria induction PMID: 23918990
  9. These results suggest that DCIR plays a protective role in limiting the Chikungunya virus-induced inflammatory response and subsequent tissue and joint damage. PMID: 23487448
  10. These observations indicate that Dcir is a negative regulator of dendritic cell expansion and has a crucial role in maintaining the homeostasis of the immune system. PMID: 18204462

Show More

Hide All

Subcellular Location Cell membrane; Single-pass type II membrane protein; Extracellular side.
Tissue Specificity Expressed in splenic antigen-presenting cells including B-cells, monocytes/macrophages, and dendritic cells (at protein level). Expressed in spleen and lymph node and slightly increased with dendritic cell maturation.
Database Links

KEGG: mmu:26888

UniGene: Mm.47384

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1