Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Clec4a; Clec4a2; Clecsf6; DcirC-type lectin domain family 4 member A; C-type lectin superfamily member 6; Dendritic cell immunoreceptor; CD antigen CD367
Species
Mus musculus (Mouse)
Expression Region
70-238aa
Target Protein Sequence
QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Mouse Clec4a covers amino acids 70-238. The expected molecular weight for the Clec4a protein is calculated to be 39.6 kDa. This protein is generated in a e.coli-based system. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of Clec4a, making it easier to detect and purify the Clec4a recombinant protein in the later stages of expression and purification.
Mouse C-type lectin domain family 4 member A (Clec4a) is a protein belonging to the C-type lectin domain family. Clec4a acts as a pattern recognition receptor (PRR) involved in the recognition of various pathogens, particularly fungi. It contains a C-type lectin domain that binds to carbohydrates on the surface of pathogens, initiating immune responses. Clec4a is primarily expressed in immune cells, such as dendritic cells and macrophages. Upon ligand binding, Clec4a activates signaling pathways that contribute to the immune response against invading microorganisms. The role of Clec4a in pathogen recognition makes it an essential component of the innate immune system, contributing to host defense against infections.