Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial

In Stock
Code CSB-EP874136MO
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Clec4a
Uniprot No.
Research Area
Immunology
Alternative Names
Clec4a; Clec4a2; Clecsf6; DcirC-type lectin domain family 4 member A; C-type lectin superfamily member 6; Dendritic cell immunoreceptor; CD antigen CD367
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
70-238aa
Target Protein Sequence
QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
39.6kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Mouse Clec4a covers amino acids 70-238. The expected molecular weight for the Clec4a protein is calculated to be 39.6 kDa. This protein is generated in a e.coli-based system. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of Clec4a, making it easier to detect and purify the Clec4a recombinant protein in the later stages of expression and purification.

Mouse C-type lectin domain family 4 member A (Clec4a) is a protein belonging to the C-type lectin domain family. Clec4a acts as a pattern recognition receptor (PRR) involved in the recognition of various pathogens, particularly fungi. It contains a C-type lectin domain that binds to carbohydrates on the surface of pathogens, initiating immune responses. Clec4a is primarily expressed in immune cells, such as dendritic cells and macrophages. Upon ligand binding, Clec4a activates signaling pathways that contribute to the immune response against invading microorganisms. The role of Clec4a in pathogen recognition makes it an essential component of the innate immune system, contributing to host defense against infections.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.; C-type lectin receptor that binds carbohydrates mannose and fucose but also weakly interacts with N-acetylglucosamine (GlcNAc) in a Ca(2+)-dependent manner. Involved in regulating immune reactivity. Once triggered by antigen, it is internalized by clathrin-dependent endocytosis and delivers its antigenic cargo into the antigen presentation pathway resulting in cross-priming of CD8(+) T cells. This cross-presentation and cross-priming are enhanced by TLR7 and TLR8 agonists with increased expansion of the CD8(+) T cells, high production of IFNG and TNF with reduced levels of IL4, IL5 and IL13. In plasmacytoid dendritic cells, inhibits TLR9-mediated IFNA and TNF production. May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.
Gene References into Functions
  1. DCIR modulates immunity to M. tuberculosis through sustaining type I IFN signaling in DCs, which reduces IL-12-p70 production and Th1 expansion. As a consequence, DCIR-deficient mice control M. tuberculosis infection better than their WT counterparts but also develop more immunopathology in the lungs. PMID: 28069953
  2. this study shows that upon injection of d-galactosamine and lipopolysaccharide, Dcir1-/- mice show decreased mortality rates and serum levels of alanine aminotransferase PMID: 28127756
  3. Dcir1 enhances the pathogenesis of DSS colitis by altering neutrophil recruitment and their functions. PMID: 26497661
  4. While DCIR1 was ubiquitously expressed on myeloid cells in various immune organs, significant expression of DCAR2 was detected only on subpopulations of conventional dendritic cells from bone marrow and skin-draining lymph nodes. PMID: 26431873
  5. MCL-/- as well as DCIR-/- mice exhibited only a slightly increased severity of disease compared to wild-type mice indicating a limited role for MCL and DCIR in the regulation of intestinal immunity. PMID: 25068517
  6. our findings show that DCIR plays an important role in maintaining bone homeostasis. PMID: 25926676
  7. DCIR is a novel receptor for IVIg, mediating interaction of innate and adaptive immunity in tolerogenic responses. PMID: 24210883
  8. This study indicates that DCIR is critically involved in Cerebral malaria induction PMID: 23918990
  9. These results suggest that DCIR plays a protective role in limiting the Chikungunya virus-induced inflammatory response and subsequent tissue and joint damage. PMID: 23487448
  10. These observations indicate that Dcir is a negative regulator of dendritic cell expansion and has a crucial role in maintaining the homeostasis of the immune system. PMID: 18204462

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein; Extracellular side.
Tissue Specificity
Expressed in splenic antigen-presenting cells including B-cells, monocytes/macrophages, and dendritic cells (at protein level). Expressed in spleen and lymph node and slightly increased with dendritic cell maturation.
Database Links

KEGG: mmu:26888

UniGene: Mm.47384

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*