Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Cbln4

Uniprot No.

Q8BME9

Research Area

Immunology

Alternative Names

Cerebellin-like glycoprotein 1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

25-198aa

Target Protein Sequence

QNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLLGGWQYSTFSGFLVFPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Acts as a synaptic organizer in specific subsets of neurons in the brain. Essential for the formation and maintenance of inhibitory GABAergic synapses. Promotes the development of dendrite-targeting inhibitory GABAergic synapses made by somatostatin-positive interneurons. May contribute to the function of ventral medial habenula region of the brain implicated in the regulation of anxiety-related behaviors. May play a role in CBLN3 export from the endoplasmic reticulum and secretion.

Gene References into Functions

Cbln2 and Cbln4 are expressed in distinct MHb neurons that contribute to different behaviors. PMID: 30287486
Results show that Cbln1, Cbln2, and Cbln4 are abundantly expressed in nearly all brain regions, but exhibit strikingly different expression patterns and developmental dynamics. Using newly generated knockin reporter mice for Cbln2 and Cbln4, we find that Cbln2 and Cbln4 are not universally expressed in all neurons, but only in specific subsets of neurons. PMID: 28714144
It is a synaptic protein, enhances inhibitory activity and resistance of neurons to amyloid-beta toxicity. PMID: 25534236
that neurons expressing Cblns 1, 2, and 4 tend to occupy different laminar positions within the dorsal spinal cord PMID: 23853053
SRY and SOX9 contribute to the male-specific upregulation of Cbln4 in the developing testis. PMID: 19211811

Hide All

Subcellular Location

Secreted. Cell junction, synapse.

Tissue Specificity

Expressed in brain with high levels in particular thalamic nuclei. In the thalamus, predominantly expressed in neurons within the parafascicular nucleus. Found in the hippocampus, mostly in the dendrites and somata of pyramidal neurons (at protein level).

Database Links

KEGG: mmu:228942

STRING: 10090.ENSMUSP00000085263

UniGene: Mm.40555

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP805305MO
Abbreviation	Recombinant Mouse Cbln4 protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Cerebellin-4 (Cbln4)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage