Recombinant Mouse Chitinase domain-containing protein 1(Chid1) ,partial

Code CSB-BP835645MO
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. Q922Q9
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL
Research Area Tags & Cell Markers
Source Baculovirus
Gene Names Chid1
Expression Region 20-393aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal 6xHis-tagged
Mol. Weight 44.7kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro) (By similarity).
Subcellular Location Secreted, Lysosome
Protein Families Glycosyl hydrolase 18 family
Database Links

KEGG: mmu:68038

STRING: 10090.ENSMUSP00000130360

UniGene: Mm.245355

Related Products

Chid1 Antibodies

Chid1 Antibodies for Homo sapiens (Human)

Chid1 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

Chid1 Proteins

Chid1 Proteins for Rattus norvegicus (Rat)

Chid1 Proteins for Bos taurus (Bovine)

Chid1 Proteins for Dictyostelium discoideum (Slime mold)

Chid1 Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Chid1 Proteins for Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Chid1 Proteins for Xenopus laevis (African clawed frog)

Chid1 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Chid1 Proteins for Mus musculus (Mouse)

Chid1 Proteins for Homo sapiens (Human)

Chid1 cDNA

Chid1 cDNA for Rattus norvegicus (Rat)

Chid1 cDNA for Danio rerio (Zebrafish) (Brachydanio rerio)

Chid1 cDNA for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Chid1 cDNA for Mus musculus (Mouse)

Chid1 cDNA for Homo sapiens (Human)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.