Recombinant Mouse Complement C3(C3),partial

In Stock
Code CSB-EP365507MO
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names C3
Uniprot No. P01027
Research Area Others
Alternative Names C3Complement C3; HSE-MSF) [Cleaved into: Complement C3 beta chain; C3-beta-c; C3bc); Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein; ASP; C3adesArg); Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment; Complement C3f fragment; Complement C3c alpha' chain fragment 2]
Species Mus musculus (Mouse)
Source E.coli
Expression Region 1321-1663aa
Target Protein Sequence SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 55.3kDa
Protein Length Partial
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

I ask for the concentration of the current lot CSB-EP365507MO? Would you have this information available that you could share?

A:
Very nice to receive your inquiry. The concentration of the current lot is 1mg/ml. The details are as below.
Code: CSB-EP365507MO
Name: Recombinant Mouse Complement C3(C3) ,partial
Expression Region: 1321-1663aa, partial
Tag Info: N-terminal 6xHis-SUMO-tag
Target Protein Sequence:

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTES
MVVYGCPN


Lead Time: 3-5 working days
Q:

I would like to know the concentration of the following protein (CSB-EP365507MO):
http://www.cusabio.com/Recombinant-Protein/Recombinant-Mouse-Complement-C3C3-partial-307333.html
Could you provide it for us?

A:
Thanks for your inquiry.
Expression region: 1321-1663aa, C-terminal fragment; Complement C3c alpha' chain fragment 2
Tag information: N-terminal 6xHis-sumo-tag
Concentration: 1mg/ml.
Target protein sequence:

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN

Target Data

Function C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; FUNCTION
Gene References into Functions
  1. It has been shown that key proteins in the lectin arm of this pathway, MASP1, MASP2 and C3, are expressed in the developing cortex and that neuronal migration is impaired in knockout and knockdown mice. PMID: 28462915
  2. Complement C3 role in the lung cancer progression. PMID: 29118090
  3. Data report C3 as a novel myogenic factor secreted by undifferentiated preadipocyte that enhances myogenic differentiation of fetal progenitor cells and adult cells. The results show that complement C3 molecule internalizes myogenic and adipogenic precursor cells and then promotes their differentiation. PMID: 28279023
  4. C3 deficiency can prolong MHC-II molecule mismatched skin allograft survival. PMID: 27641978
  5. C3 role in the retinal epithelium and photoreceptor degeneration PMID: 28348233
  6. These findings shed light on mechanisms of age-related retinal alterations by identifying C3 as a potential therapeutic target for retinal aging. PMID: 28928904
  7. These findings suggest that C3 protects from early glaucomatous damage, a process that may involve EGFR signaling and other immune responses in the optic nerve head. PMID: 28446616
  8. complement C3 or downstream complement activation fragments may play an important role in Abeta plaque pathology. PMID: 28566429
  9. C5 and C5aR have critical roles in the development of C3 glomerulopathy. PMID: 28139294
  10. Data show that months after irradiation (IR) complement component 3 (C3-/-) mice made fewer errors than WT mice in a reversal learning test indicating better learning capacity in C3-/- mice after IR. PMID: 27029069
  11. Study show s the regulation of C3 Activation by the Alternative Complement Pathway in the Mouse Retina PMID: 27564415
  12. Time-lapse video microscopy established the localization of the complement anaphylatoxin C3a and its receptor on enteric neural crest cells during their migration in the embryonic gut. C3a plays a role in regulating collective and directional cell migration, and in ganglia network organization during enteric nervous system ontogenesis. It regulates cell migration in a N-cadherin-dependent process. PMID: 27041467
  13. nutrient sensing in the liver is coupled to release of C3 and potentially its metabolic and inflammatory functions. PMID: 27735945
  14. Retinal C3 was expressed by microglia/macrophages located in the outer retina in AMD eyes. In rodent photo-oxidative damage, C3-expressing microglia/macrophages and complement activation were located in regions of lesion expansion in the outer retina over 2 months PMID: 28605809
  15. Wild-type C57BL/6 mice with pristane-induced lupus developed a strong IFN signature, which was absent in immunoglobulin-deficient (muMT), C3(-/-) , and CD18(-/-) mice. In vivo phagocytosis of dead cells was impaired in C3-deficient mice. PMID: 27274010
  16. Study found that cancer-cell-derived C3 activates the C3a receptor in the choroid plexus epithelium to disrupt the blood-cerebrospinal fluid (CSF) barrier. This effect allows plasma components, including amphiregulin, and other mitogens to enter the CSF and promote cancer cell growth. PMID: 28283064
  17. We induced anti-myeloperoxidase vasculitis in mice and confirmed a role for complement activation by demonstrating protection in C3-deficient mice. PMID: 27235854
  18. These data indicated that alpha7-nAChR caused the inhibition of ASPinduced activation of p38 kinase and NFkappa B to inhibit the production of MCP1 and keratinocytederived chemokine. PMID: 27572255
  19. These results suggest that GAS utilizes diverse mechanisms to degrade C3b and thus to protect bacterial cells from the complement response of the host. PMID: 26945067
  20. This study provideed the evidence that C3a plays a critical role in cerebral endothelial activation and leukocyte recruitment during inflammation in the brain. PMID: 26822321
  21. Demonstrate that cardiac Sirt1 plays an essential role in caloritc restriction-induced cardioprotection against myocardial I/R injury by suppressing cardiac C3 expression. PMID: 26873964
  22. The roles of C3, CfB, and C3a receptor in the severity of S. aureus induced septic arthritis are reported. PMID: 26787717
  23. Study shows that C3a is locally produced by -retinal pigment epithelial cells suggesting a key role in early macular degenerations pathogenesis. PMID: 26199322
  24. Complement C3 activation occurs following intramuscular islet transplantation, but it does not seem to affect the graft function. PMID: 26900812
  25. Studied whether increased levels of complement in HD brains contributed to disease progression in the R6/2 mouse model of HD. Found C3 deficiency does not alter HD progression in the R6/2 mouse model. PMID: 23097680
  26. Identify complement 5a as the major C3 activation product that was involved in macrophage polarization and DOCA-salt-induced vascular injury. PMID: 25573852
  27. our findings define the mechanism of receptor crosstalk between CR3 and Dectin-1 and demonstrate the importance of their collaboration in host defense against fungal infection. PMID: 26132276
  28. Carboxypeptidase B2 deficiency reveals that complement C3a limits infection in a murine polymicrobial sepsis model. PMID: 25851247
  29. Complement component 3 is up-regulated via non-canonical TGF-beta signaling in the retinal pigment epithelium PMID: 25802332
  30. Data indicate that for all three pathways there was a strong correlation between the amount of Ccomplement C3 (C3) fragments and the reduction in functional complement activity. PMID: 25733354
  31. Therapeutic efficacy of radiotherapy depends on C3a and C5a. PMID: 25888260
  32. C3 secreted from mycoplasma-infected Mesenchymal stem cells (MSCs) has an important role in the immunomodulatory functions of MSCs. PMID: 24763049
  33. Data indicate that absence of complement C3, complement C5 and Fc receptor subunit gamma (FcRgamma) does not impact autoantibody production in K/BxN mice. PMID: 23237573
  34. These results suggest that osteoclast-derived C3a functions in the relay from bone resorption to formation and may be a candidate for a coupling factor. PMID: 24470120
  35. Coagulation cascades, by generating thrombin and plasmin, respectively, provide C5 convertase activity, explaining why mobilization of hematopoietic stem cells in C3-deficient mice. PMID: 24667943
  36. These results provide new insights into the role of systemic C3 in regulating contraction following intracellular bacterial infection and may help to develop vaccines that are more effective. PMID: 25187659
  37. a role for outside-in iC3b-CD11b signals in limiting intrinsic organ inflammation PMID: 24632830
  38. have identified Complement C3 as a candidate plasma biomarker for measuring disease state in neuroblastoma PMID: 24200836
  39. A previously unknown function of C3a promotes protection to both myeloid and lymphoid cells against Listeria monocytogenes-induced apoptosis. PMID: 24981453
  40. Genetic and intervention studies implicating complement C3 as a major target for the treatment of periodontitis. PMID: 24808362
  41. Loss of dopaminergic neurons was rescued by complement C3-deficient mice. PMID: 24948809
  42. Complement protein C3 exacerbates prion disease in a mouse model of chronic wasting disease. PMID: 24038599
  43. Complement C3 and C5 deficiency affects bone fracture healing. PMID: 24260573
  44. Radiation combined injury-induced alterations of corticosterone, CRP, C3, IgM, and PGE2 cause homeostatic imbalance and may contribute to reduced survival. PMID: 24175013
  45. Data indicate that co-deficiency of factor H (FH) and MASP-1/MASP-3 did not ameliorate either the plasma Complement C3 (C3) activation or glomerular C3 accumulation in FH-deficient mice. PMID: 24279761
  46. The results of this study suggested that C3 plays a role in the regulation of the number and function of glutamatergic synapses in the hippocampus and exerts negative effects on hippocampus-dependent cognitive performance. PMID: 24378428
  47. C3 induces epithelial-to-mesenchymal transition and may be a primary factor to activate the renal renin-angiotensin systems to induce hypertension. PMID: 23926185
  48. Data indicate complement C3 deposition on peanut extract (PE) was abolished in immunoglobulin- and C4-deficient sera. PMID: 23182714
  49. ALI in H5N1-infected mice was caused by excessive complement activation, as demonstrated by deposition of C3, C5b-9, and MBL-C in lung tissue, and by up-regulation of MBL-associated serine protease-2 and the complement receptors C3aR and C5aR. PMID: 23526211
  50. in vitro results suggest various metabolic hormones and inflammatory factors can affect acylation stimulating protein (ASP) production and that ASP could constitute a new link between adipocytes and macrophage PMID: 23430572
  51. Chitin induces the generation of C3a in the lung, and chitin-dependent allergic sensitization to Aspergillus requires C3aR signaling, which suppresses regulatory dendritic cells and T cells and induces allergy-promoting T cells. PMID: 23549917
  52. analysis of complement activation using monoclonal antibodies against C3d PMID: 23619360
  53. the expressions of C5a and CD88 can be inhibited in different degrees after SCI when the activation of complement system is blocked through C3 deficiency. PMID: 23033813
  54. Hepatic stellate cells deficient in C3 are impaired in their ability to induce myeloid-derived suppressor cells. PMID: 23299310
  55. chronic ASP administration in C3(-/-) mice would affect lipid metabolism and insulin sensitivity via an adaptive adipose tissue inflammatory response PMID: 23056509
  56. PPARalpha positively regulates complement C3 expression but inhibits tumor necrosis factor alpha-mediated activation of C3 gene in hepatic cells. PMID: 23168409
  57. The mechanism(s) of phagocytosis in the second phase of blood incompatibility reaction required neither C3 nor FcgammaRs. PMID: 22502635
  58. Mice lacking C3aR and/or C5aR developed early onset and progressive retinal degeneration, accompanied by cleaved caspase-3 upregulation. PMID: 23074214
  59. C3a and C5a promote renal ischemia-reperfusion injury. PMID: 22797180
  60. A non-classical pathway of C3 activation is involved in axotomy-induced adult mice synapse removal, and its inhibition promotes functional recovery. PMID: 22721768
  61. Kidney injury accelerates cystogenesis via pathways modulated by heme oxygenase and complement. PMID: 22518005
  62. Significantly reduced uptake of beta-glucan particles by peritoneal monocytes/ macrophages is observed in C3-deficient mice. PMID: 22649195
  63. The complement system plays a pathophysiologic role in the development of pulmonary hypertension in mice. PMID: 22194859
  64. Mechanisms leading to the immunoglobulin (Ig)E-mediated late-phase asthmatic response and airway hyperresponsiveness are closely associated with neutrophilic inflammation through the production of IL-17 induced by complement C3a. PMID: 22539791
  65. The results of this study demonstrated that C3 and Mac-1 are involved in phagocytosis and clearance of fAbeta by microglia. PMID: 22438044
  66. Complement dysregulation in the absence of CD55 provoked increased C3adesArg production that, in turn, caused altered lipid handling, resulting in atheroprotection and increased adiposity. PMID: 21816131
  67. heightened production and activation of immune cell-derived complement bypasses the need for CD40/CD154 interactions and implicate antigen-presenting cell-produced C5a and C3a as molecular bridges linking CD4 help to CD8(+) T cells PMID: 21704012
  68. C3 and C5 Complement activation triggers MMP9 metalloproteinases release inducing cervical remodeling and preterm birth in mice PMID: 21801872
  69. C3 is involved with ventilator-induced lung injury and inhibition of complement activation may be a potential therapeutic strategy. PMID: 21979496
  70. C3-dependent microglial priming confers susceptibility to other challenges. PMID: 22219359
  71. IL-4 regulates liver regeneration by controlling complement activation and the subsequent induction of IL-6. PMID: 22184721
  72. role of C3 in T cell-mediated allergic contact dermatitis, which is a clinical manifestation of contact sensitivity PMID: 21569105
  73. C3 and C4 bind to collagen and elastin in the vascular wall and have a potential role in vascular stiffness and atherosclerosis PMID: 21707943
  74. Higher number of CD4+CD25+ regulatory T cells (Tregs) with characteristics of expressing Foxp3 was observed in C3-/- mice. These C3-/- Tregs exhibited enhanced suppressive capacity to effector cell proliferation. PMID: 21767994
  75. IgG autoantibodies were responsible for the inhibition, through the blockade of C3 recognition by macrophages PMID: 21813769
  76. the complement system and its component C3 participate in the regulation of T cell responses, and that complement function is required for normal T helper cell differentiation. PMID: 21074891
  77. Adenovirus-mediated delivery of C3 to murine RPE induces significant functional and anatomic changes that reproduce many of the features of AMD as well as those of other retinal diseases. PMID: 21357400
  78. results showed C3 mRNA exhibited biphasic patterns in heart allograft; 1st phase correlated with ischemic reperfusion injury over 2 days post-transplant; 2nd peak was found only in allografts on day 5, concurrent with secretion of IL2 and IFN-gamma PMID: 20970501
  79. C3 was required for protection from influenza infection. PMID: 21408070
  80. Ubiquitous surface protein (Usp)A of Moraxella catarrhalis binds C3 blocking complement activation and inhibiting C3a-mediated inflammation. PMID: 21270401
  81. Data with immunochemical analyses showed the specific presence of C3 on the visceral yolk sac. PMID: 20712003
  82. Although complement receptor (CR)2 is critical, complement 3 ligands are not required for the production of pathogenic autoreactive antibodies. PMID: 21187447
  83. Mice deficient in the central complement component C3 displayed increased neovascularization in the model of retinopathy of prematurity (ROP) and in the in vivo Matrigel plug assay. PMID: 20625009
  84. C3(-/-) bone marrow cells exhibited lower RANKL/OPG expression ratios, produced smaller amounts of macrophage colony-stimulating factor and interleukin-6, and generated significantly fewer osteoclasts than wild-type bone marrow cells. PMID: 20709903
  85. Genetic ablation of complement C3 attenuates muscle pathology in dysferlin-deficient mice. PMID: 21060153
  86. C3 deficiency can inhibit inflammation through suppressing ASTs activation and TNF-alpha expression, thereby reducing secondary injury and improving neural regeneration and functional recovery after spinal cord injury. PMID: 20800648
  87. Complement C3 activation contributes to inflammatory pathways and liver damage in hemorrhagic shock/trauma. PMID: 20702808
  88. Through direct interaction, C3a and CpGA synergize to increase IFN-alpha production in a RAGE-dependent manner and stimulate an innate immune response. PMID: 20817881
  89. Key role for immune cell-derived C3 in the pathogenesis of murine multiple low-dose streptozotocin-induced diabetes inh mice. PMID: 20584999
  90. Mouse embryos facilitated such conversion of C3 to C3b, which was taken up by the embryos, resulting in the formation of more blastocysts of larger size. PMID: 18039777
  91. These studies indicate that C3 participates in the induction of acute seizures during viral encephalitis. PMID: 20427530
  92. In the C-reactive protein transgenic mouse model of carotid artery injury, mouse C3 is essential for the effect of human CRP. PMID: 20339115
  93. Robust generation of both C3a and C5a by either the alternative pathway or classical pathway alone were observed with both mouse and human sera, after adherent IgG-induced complement activation. PMID: 19843088
  94. CR2-induced complement activation results in membrane depolarization, as indicated by annexin V binding, with kinetics similar to those of C3-fragment deposition and different from those of membrane attack complex formation. PMID: 19740327
  95. Complement 3 is not essential to the development of a lupus-like phenotype in lpr mice. PMID: 11801636
  96. Administration of an estrogenic steroid to immature or ovariectomized adult mice markedly stimulated the expression of Bf, C3, and their RNA messages in the endometrium PMID: 11804945
  97. in vivo complement activation is required for aPL antibody-induced fetal loss and growth retardation PMID: 11805148
  98. synthesis regulates acute renal graft rejection PMID: 12042808
  99. Homozygous C3-deficient mice are highly resistant to collagen-induced arthritis and display a decreased type II collagen-specific IgG antibody response, which can be boosted by repeated immunization. PMID: 12077276
  100. The failure of up-regulation of C3 in Il-6 deficient mice contributes to their resistance to induction of antibody-mediated experimental autoimmune myasthenia gravis. PMID: 12097416

Show More

Hide All

Subcellular Location Secreted
Database Links

KEGG: mmu:12266

STRING: 10090.ENSMUSP00000024988

UniGene: Mm.19131

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1