Recombinant Mouse Complement C3(C3),partial

In Stock
Code CSB-EP365507MO
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01027
Lead Time 3-7 business days
Relevance C3 plays a central role in the activation of the complent syst. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.Derived from proteolytic degradation of complent C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a choattractant for neutrophils . It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. The short isoform has B-cell stimulatory activity.C3-beta-c: Acts as a choattractant for neutrophils in chronic inflammation.Acylation stimulating protein: adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias HSE-MSF
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN
Research Area Others
Source E.coli
Gene Names C3
Protein Names Recommended name: Complement C3Alternative name(s): HSE-MSFCleaved into the following 10 chains: 1. Complement C3 beta chain 2. Complement C3 alpha chain 3. C3a anaphylatoxin 4. Complement C3b alpha' chain 5. Complement C3c alpha' cha
Expression Region 1321-1663aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 55.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; FUNCTION
Subcellular Location Secreted
Database Links

KEGG: mmu:12266

STRING: 10090.ENSMUSP00000024988

UniGene: Mm.19131

Pathway Complement and coagulation cascades

Q&A and Customer Reviews

Q&A
Q:

I ask for the concentration of the current lot CSB-EP365507MO? Would you have this information available that you could share?

A:
Very nice to receive your inquiry. The concentration of the current lot is 1mg/ml. The details are as below.
Code: CSB-EP365507MO
Name: Recombinant Mouse Complement C3(C3) ,partial
Expression Region: 1321-1663aa, partial
Tag Info: N-terminal 6xHis-SUMO-tag
Target Protein Sequence:

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTES
MVVYGCPN


Lead Time: 3-5 working days
Q:

I would like to know the concentration of the following protein (CSB-EP365507MO):
http://www.cusabio.com/Recombinant-Protein/Recombinant-Mouse-Complement-C3C3-partial-307333.html
Could you provide it for us?

A:
Thanks for your inquiry.
Expression region: 1321-1663aa, C-terminal fragment; Complement C3c alpha' chain fragment 2
Tag information: N-terminal 6xHis-sumo-tag
Concentration: 1mg/ml.
Target protein sequence:

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN

Customer Reviews

Related Products

C3 Antibodies

C3 Antibodies for Mouse

C3 Proteins

C3 Proteins for Mus musculus (Mouse)

C3 ELISA Kit

C3 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.