Recombinant Mouse D-dopachrome decarboxylase(Ddt)

Code CSB-EP006598MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. O35215
Relevance Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias D-dopachrome tautomerase
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
Research Area Others
Source E.coli
Gene Names Ddt
Expression Region 2-118aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
Subcellular Location Cytoplasm
Protein Families MIF family
Database Links

KEGG: mmu:13202

STRING: 10090.ENSMUSP00000001716

UniGene: Mm.298947

Related Products

Ddt Antibodies

Ddt Antibodies for Mus musculus (Mouse)

Ddt Proteins

Ddt Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.