Recombinant Mouse Dickkopf-related protein 4 (Dkk4)

In Stock
Code CSB-EP837727MO
Abbreviation Recombinant Mouse Dkk4 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Dickkopf-4;Dkk-4
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
19-221aa
Target Protein Sequence
LVLDFNNIKSSADVQGAGKGSLCASDRDCSEGKFCLAFHDERSFCATCRRVRRRCQRSAVCCPGTVCVNDVCTAVEDTRPVMDRNTDGQDGAYAEGTTKWPAEENRPQGKPSTKKSQSSKGQEGESCLRTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPGLTCRSQVTSNRQHSRLRVCQRI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
Gene References into Functions
  1. the dynamic state of Dkk4 itself and its interaction with Lrp6 modulates Wnt function during Meibomian gland development, with a novel limitation of Dkk4 action by proteolytic cleavage. PMID: 27864382
  2. sweat gland development shows a relay of regulatory steps initiated by Wnt/beta-catenin - itself modulated by Dkk4 - with subsequent participation of Eda and Shh pathways. PMID: 25249463
  3. These results showed that Dkk4 functions as an inhibitor of osteoblastogenesis through Wnt/beta-catenin signaling, providing new insights into the relationship between Wnt/beta-catenin signaling and Dkk4 in bone formation. PMID: 24105477
  4. It would appear that deregulation of the WNT pathway by overexpression of DKK4 may further impair WNT signaling and lead to Anorectal malformations. PMID: 23108157
  5. Dkk4 affects an auxiliary pathway for Eda-independent development of secondary hair PMID: 20386733
  6. Dkk4 acts in a negative feedback loop to attenuate canonical Wnt signaling and may facilitate a switch to the non-canonical Wnt planar cell polarity pathway that is involved in cell movements during morphogenesis. PMID: 17397822
  7. Microarray profiling of genes differentially regulated by short exposure to recombinant Eda-A1 in embryonic eda(-/-) skin explants, was performed to identify direct targets of ectodysplasin pathway. PMID: 18508042

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Dickkopf family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*