Home
Protein
Recombinant Proteins
Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial

Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial

^{In Stock}

Code	CSB-EP878117MO
Abbreviation	Recombinant Mouse Ecel1 protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Ecel1

Uniprot No.

Q9JMI0

Research Area

Neuroscience

Alternative Names

Ecel1; Dine; XceEndothelin-converting enzyme-like 1; EC 3.4.24.-; Damage-induced neuronal endopeptidase; Xce protein

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-61aa

Target Protein Sequence

MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.7 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Mouse Ecel1 protein expression in e.coli cells requires the insertion of a DNA fragment encoding the Mouse Ecel1 protein (1-61aa) into a plasmid vector and the transferral of this vector into e.coli cells. The positive cells are screened, cultured, and then induced to express the Ecel1 protein. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. The cells are lysed to harvest the recombinant Mouse Ecel1 protein, which is purified through affinity purification and then detected by SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of this recombinant Mouse Ecel1 protein is over 85%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.

Gene References into Functions

This study demonstrated that the ECEL1/DINE G607S and C760R mutations both lead to motor innervation defects as primary causes in ECEL1-mutated congenital contracture disorders. PMID: 29132416
DINE is expressed in cranial and spinal motor neurons both embryonically and after CNS injury PMID: 27656015
DINE enhances axonal regeneration potential of retinal ganglion cells after optic nerve injury. PMID: 28569783
Using two different DINE mutant mice, study found that DINE functional disruption leads to impaired axonal arborization of motor nerves in limb muscles. PMID: 26951213
The data of this study suggested that DINE is a crucial molecule in distal axonal arborization into muscle to establish neuromuscular junctions. PMID: 20484637

Hide All

Subcellular Location

Membrane; Single-pass type II membrane protein.

Protein Families

Peptidase M13 family

Database Links

KEGG: mmu:13599

STRING: 10090.ENSMUSP00000027463

UniGene: Mm.140765

Promotions