Recombinant Mouse Ephrin-B3 (Efnb3), partial

Code CSB-BP007467MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP007467MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP007467MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Efnb3
Uniprot No.
Research Area
Others
Alternative Names
Efnb3Ephrin-B3
Species
Mus musculus (Mouse)
Expression Region
28-227aa
Target Protein Sequence
LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA
Mol. Weight
24kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
Gene References into Functions
  1. EphA2 mAb treatment could partially inhibit LPSinduced inactivation of EphBEphrin B3 signalling, while Ephrin B3 overexpression could abrogate LPSinduced activation of EphA2Ephrin A1 signalling. EphB1/Ephrin B3 signalling may antagonise the EphA2/Ephrin A1dependent pathway following LPS treatment PMID: 29901151
  2. Data suggest that molecules in the erythropoietin-producing hepatocellular receptor B family (EPHB) / ephrinB (EFNB) signalling pathways, specifically ephrin B3 and GRIP1, are involved blood pressure regulation. PMID: 27941904
  3. ephrin B3/EphB2 are obvious candidates for driving the Syk-dependent repulsive response. PMID: 27122172
  4. The Eph/ephrin-B3-mediated heterotypic or homotypic cell interactions between thymocytes and thymic epithelial cells (TECs), or between TECs and themselves, contribute to the early maturation of MTS20(+) TECs. PMID: 27060907
  5. Findings suggest that EphrinB3 may be a relevant target for promoting remyelination in demyelinating disease PMID: 26687980
  6. The morphological and behavioural abnormalities in ephrin-B3 mutant mice are rescued by conditional knock-in of wild-type ephrin-B3 during the critical period when axon targeting and fear responses are initiated. PMID: 27008987
  7. Ephrin-B3 knockout mice had significantly reduced pre-pulse inhibition compared with controls. PMID: 24949848
  8. Conclude that EphB3 mediates cell death in the adult cortex through a novel dependence receptor-mediated cell death mechanism in the injured adult cortex and is attenuated following ephrinB3 stimulation. PMID: 24810043
  9. findings indicate that a single guidance system, ephrinB3/EphA4, controls the formation of ascending and descending longitudinal axons in the spinal cord. PMID: 24360544
  10. these data introduce EphB3 as a new biomarker to identify beta-cells at a critical step during their step-wise differentiation and define the timeframe of endocrine differentiation. PMID: 22434763
  11. Induction of experimental stroke results in enhanced cell proliferation and neuronal differentiation around the lesion site of ephrin-B3-deficient compared to ephrin-B3-expressing mice. PMID: 21779764
  12. EphrinB3 contributes to myelin-derived axonal growth inhibition and limits recovery from adult central nervous system trauma. PMID: 22411787
  13. cell contact-mediated bidirectional ephrinB3/EphA4 signaling mediates the sorting of medial ganglionic eminence- and preoptic area-derived interneurons in the deep and superficial migratory stream. PMID: 22171039
  14. This study demonistrated tht ephrin-B reverse signaling into three distinct intracellular pathways and protein-protein interactions that mediate the maturation of postsynaptic neurons. PMID: 21964490
  15. These studies support an anti-proliferative role for EphB3 in regulating neural stem/progenitor cell numbers in the developing subventricular zone. PMID: 20969945
  16. found that ablation of ephrin-B3 results in an enhancement of the NMDA receptor component of synaptic transmission relative to the AMPA receptor component in CA1 synapses PMID: 20678574
  17. Ephrinb3 is directly involved in the specificity of mesostriatal projection. PMID: 20719236
  18. conclude that ephrinB3-induced EphA4 signaling repels some components of the mammalian spinal central pattern generators (CPG) and restricts their axonal projections to one side of the spinal cord PMID: 12649481
  19. Organ of Corti and spiral ganglion showed strong expression of ephrin-A3, ephrin-B2 and ephrin-B3. PMID: 12684176
  20. EFNB3-Fc in the presence of suboptimal anti-CD3 crosslinking enhanced T-cell responses in terms of proliferation, activation marker expression, interferon-gamma but not interleukin-2 production, and cytotoxic T-cell activity PMID: 13679370
  21. Ephrin-B3 is a myelin-based inhibitor of neurite outgrowth. PMID: 16020529
  22. May act like a receptor by transducing reverse signals in order to regulate the number of synapses formed in the hippocampus. May stimulate forward signaling to modulate a number of other proteins involved in synaptic activity, learning, and memory. PMID: 16466709
  23. Data show that ephrinB3 contributes to the control of cell proliferation and survival in the adult subventricular zone. PMID: 16483793
  24. Novel mechanism for independent modulation of shaft synapses through ephrinB3 reverse signaling. PMID: 17626212
  25. Rac-GAP alpha-chimerin regulates motor-circuit formation as a key mediator of Efnb3 forward signaling. PMID: 17719550
  26. A previously unknown pathway is revealed that controls axon pruning by which ephrin-B3 reverse signals regulate actin dynamics to bring about the retraction of growth cones. PMID: 19182796

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Ephrin family
Tissue Specificity
Expressed on lateral floor plate cells, specifically on commissural axon segments that have passed through the floor plate. Expressed in cells of the retinal ganglion cell layer during retinal axon guidance to the optic disk. Expressed in myogenic progeni
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1