Recombinant Mouse Ficolin-1 (Fcn1)

In Stock
Code CSB-EP008550MOa0
Abbreviation Recombinant Mouse Fcn1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
18-334aa
Target Protein Sequence
SQALGQERGACPDVKVVGLGAQDKVVVIQSCPGFPGPPGPKGEPGSPAGRGERGFQGSPGKMGPAGSKGEPGTMGPPGVKGEKGDTGAAPSLGEKELGDTLCQRGPRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSIDFFRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKYKLTLGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRYLSGSHESYADGINWGTGQGHHYSYKVAEMKIRAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Extracellular lectin functioning as a pattern-recognition receptor in innate immunity. Binds the sugar moieties of pathogen-associated molecular patterns (PAMPs) displayed on microbes and activates the lectin pathway of the complement system. May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8. Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage.
Gene References into Functions
  1. Ficolin-2 induces macrophage activation, promotes M1 polarization and facilitates proliferation and antigen-specific cytotoxicity of CD8(+) T cells. Ficolin-2 binds to Toll-like receptor 4 (TLR4) on macrophages and DCs and promotes their antigen-presenting abilities to CD8(+) T cells. PMID: 28844702
  2. this study demonstrates that ficolins are important in initial innate host defense against Aspergillus fumigatus infections in vivo PMID: 27467404
  3. this study shows that FCN-A/2 exacerbated the inflammatory pathogenesis of inflammatory bowel disease by stimulating M1 polarization through the TLR4/MyD88/MAPK/NF-kappaB signalling pathway in macrophages PMID: 28380665
  4. FcnA-deficient and FcnA/ficolin B double-deficient mice lack FcnA-mediated complement activation in the sera, because of absence of complexes comprising FcnA and MBL-associated serine proteases. PMID: 23150716
  5. the binding properties of the murine serum ficolin-A towards a panel of different clinical relevant microorganisms PMID: 22666482
  6. binds to the glycoproteins hemagglutinin and neuraminidase and inhibits influenza A virus infection both in vitro and in vivo PMID: 22399010
  7. Recombinant mouse ficolin A, mannose-binding lectin-A, and mannose-binding lectin-C bound to fibrinogen in a dose-dependent manner. The lectin pathway, through mannose-binding lectins, synchronized with blood coagulation. PMID: 20375621
  8. the expression pattern of ficolin A expression was closely similar to that of mannose-binding lectin-associated serine proteases, suggesting that these molecules may function in coordination as components of the lectin complement pathway PMID: 15950722
  9. Ficolin A protein (smapshowed a potent complement activating capacity.These results suggest that ficolin A and its variant function as recognition molecules of the lectin pathway. PMID: 16328467
  10. A functionally relevant signal peptide of ficolin A was identified by using mass spectrometry analysis to determine the N-terminal sequence of secreted ficolin A. PMID: 17669269

Show More

Hide All

Subcellular Location
Secreted. Cell membrane; Peripheral membrane protein; Extracellular side.
Protein Families
Ficolin lectin family
Tissue Specificity
Highly expressed in liver and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*