Recombinant Mouse GA-binding protein alpha chain (Gabpa)

Unavailable
Code CSB-EP4582MO
Abbreviation Recombinant Mouse Gabpa protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
(GABP subunit alpha)
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-454aa
Target Protein Sequence
MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETVEVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVPPATPTTIKVINSSAKAAKVQRSPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIECEQKKLARMQLHGIAQPVTAVALAATSLQADKEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
78.0 kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor capable of interacting with purine rich repeats (GA repeats).
Gene References into Functions
  1. Depletion of GABPalpha impairs T-cell homeostatic survival, proliferation, and antigen-induced responses in vivo. PMID: 29051483
  2. conditionally deleted Gabpa, the DNA-binding component of this transcription factor complex, from embryonic fibroblasts to examine the role of Gabp in mitochondrial biogenesis, function, and gene expression PMID: 24958105
  3. Loss of Gabpalpha prevented development of CML, although mice continued to generate BCR-ABL-expressing Gabpalpha-null cells for months that were serially transplantable and contributed to all lineages in secondary recipients. PMID: 23345428
  4. NRF-2 and NRF-1 operate in a concurrent and parallel manner in mediating the tight coupling between energy metabolism and neuronal activity at the molecular level. PMID: 23085505
  5. Through genome-wide mapping of GABPalpha binding and transcriptomic analysis of GABPalpha-deficient HSCs, we identified Zfx and Etv6 transcription factors and prosurvival Bcl-2 family members including Bcl-2, Bcl-X(L), and Mcl-1 as direct GABP target genes. PMID: 21139080
  6. Disruption of Gabpa was associated with a marked reduction in myeloid progenitor cells, and Gabpalpha null myeloid cells express reduced levels of the transcriptional repressor, Gfi-1. PMID: 21705494
  7. chemical shift and secondary structure of the PNT/SAM domains PMID: 12449421
  8. phosphorylation of threonine 280 in GABPalpha triggers reorganizations of the quaternary structure of GABP PMID: 14585962
  9. Erralpha and GA-binding protein a partner with PGC-1alpha in muscle to form a double-positive-feedback loop that drives the expression of many oxidative phosphorylation genes PMID: 15100410
  10. Gabpa function is essential and is not compensated for by other ETS transcription factors and is consistent with a specific requirement for Gabp expression for the maintenance of target genes involved in embryo essential mitochondrial cellular functions PMID: 15199140
  11. GABP is essential for the regulation of IL-7Ralpha expression in T cells. PMID: 15361867
  12. Binding of GABP to the GAA/CF6 bi-directional promoter provides the potential for autoregulation of GABP alpha expression and confirms the importance of GABP in the coordinate expression of respiratory chain components PMID: 16309857
  13. GABPalpha upregulates the expression of Oct-3/4 via downregulation of Oct-3/4 repressors. PMID: 17194449
  14. GABPalpha is necessary and sufficient for re-entry into the cell cycle and it regulates a pathway that is distinct from that of D-type cyclins and CDKs. PMID: 17277770
  15. GABP transcription factor aids in the structural formation and function of neuromuscular junctions by regulating the expression of postsynaptic genes PMID: 17325042
  16. Deficiency of GABPalpha, the DNA-binding subunit of GABP, resulted in profoundly defective B cell development and a compromised humoral immune response, in addition to thymic developmental defects. PMID: 17442597
  17. These data indicate that GABP is dispensable for synapse-specific transcription and maintenance of normal acetylcholine receptor expression at synapses. PMID: 17485447
  18. Because NRG-1 signaling is not expected to alter the function of the C-terminal region, which remains in these cells, these results suggest that GABPbeta, or other interacting components, rather than GABPalpha directly, is targeted by NRG-1 signaling. PMID: 17975830
  19. Ther is a direct structural link between GABP and a central component of the transcriptional machinery. PMID: 18295234
  20. Il7ra promoter acetylation and activity was dependent on the reciprocal binding of GABPalpha and Gfi-1. Data provide a biochemical mechanism for the generation of stable IL-7Ralpha(high) and IL-7Ralpha(low) states in virus-specific effector CD8 T cells. PMID: 18390712
  21. functional relevance of the -119 GABP-binding site in the Robo4 promoter in vivo PMID: 18519813

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
ETS family
Tissue Specificity
Ubiquitous.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*