Recombinant Mouse Glucagon receptor (Gcgr), partial

In Stock
Code CSB-EP009316MO
Abbreviation Recombinant Mouse Gcgr protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
GcgrGlucagon receptor; GL-R
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
27-143aa
Target Protein Sequence
AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Data, including data from studies using knockout mice, suggest that control of whole-body energy expenditure by Gcgr agonism requires intact Fxr signaling and Fgf21 secretion in liver. (Gcgr = glucagon receptor glucagon; Fxr = farnesoid X receptor; Fgf21 = fibroblast growth factor-21) PMID: 29925501
  2. we show that glucagon receptor (GCGR) inhibition with a monoclonal antibody normalized blood glucose and beta-hydroxybutyrate levels. Insulin receptor antagonism increased pancreatic beta-cell mass threefold. Normalization of blood glucose levels with GCGR-blocking antibody unexpectedly doubled beta-cell mass relative to that observed with S961 alone and 5.8-fold over control PMID: 28115707
  3. These results show that Slc38a5 is a key component of the feedback circuit between glucagon receptor signaling in the liver and amino-acid-dependent regulation of pancreatic alpha cell mass in mice. PMID: 28591637
  4. GcgR knockout (Gcgr(-/-)) mice displayed lower blood glucose levels accompanied by elevated plasma ghrelin levels. Hyperglycemia was averted in streptozocin treated Gcgr(-/-) mice and the plasma ghrelin level was further increased. PMID: 28487437
  5. glucagon receptor antagonist improves glycemia in diet-induced obese angptl4 knockout mice without increasing glucagon levels or alpha-cell proliferation, underscoring the importance of this protein. PMID: 26621734
  6. Data indicate that the exocrine pancreas in the glucagon receptor Gcgr-/- mice exhibited larger nuclear size than in WT or heterozygous controls, most obviously at old ages. PMID: 24326371
  7. Simultaneous and sufficient activation of GLP1R is required to reduce GCCR mediated blood glucose elevation following administration of a GLP1R/GCGR co-agonist. PMID: 23203689
  8. Knockdown of liver glucagon receptor in mice reduces blood glucose and increases blood LDL levels. PMID: 23828778
  9. Gcgr(-/-) mice became lethargic & cachexic & died early. Autopsy revealed numerous PNETs up to 15 mm in diameter in most well-preserved Gcgr(-/-) pancreata. PMID: 22951296
  10. Data suggest that GcgR activation raises hepatic expression of fibroblast growth factor 21 (FGF21) and increases circulating levels of FGF21; GcgR activation induces body weight loss and stimulates lipid metabolism. PMID: 23305646
  11. These results suggest that a circulating factor generated after disruption of hepatic Gcgr signaling can increase alpha-cell proliferation independent of direct pancreatic input. PMID: 23160527
  12. GRA1 is a potent glucagon receptor antagonist with strong antihyperglycemic efficacy in preclinical models and prominent effects on hepatic gene-expression related to amino acid metabolism PMID: 23185367
  13. Data suggest that both Gcgr activity and glucagon-like peptide 1/Glp1r signal transduction in central nervous system are involved in control of interscapular brown adipose tissue thermogenesis. PMID: 22933116
  14. A novel transgenic mouse was generated which had muscle specific expression of glucagon receptor. The transgenic mice maintained an appropriate ratio of glucagon to insulin, which appears important in maintaining glucose homeostasis. PMID: 22318544
  15. in addition to activation of the classic cAMP/protein kinase A (PKA) pathway, activation of GCGR also induced beta-catenin stabilization and activated beta-catenin-mediated transcription PMID: 22438981
  16. Data from glucagon receptor knockout mice suggest that glucagon receptor action and glucagon/glucagon receptor signaling contribute to normal female reproductive function (i.e., normal ovulation, placentation, and fetal development). PMID: 22167521
  17. ChREBP directly regulates rat Gcgr expression in INS-1E cells. PMID: 22198437
  18. Defective glucagon signaling causes pancreatic neuroendocrine tumors in the Gcgr(-/-) mice. PMID: 21853126
  19. complete ablation of hepatic glucagon receptor function results in major metabolic alterations in the liver PMID: 21631939
  20. functional plasticity in the enteroinsular axis involves GLP1R and GcgR and induction of compensatory mechanisms that control nutrient-dependent regulation of insulin secretion PMID: 21540554
  21. Blocking glucagon action by knocking out glucagon receptors prevents type 1 diabetes mellitus in mice. PMID: 21270251
  22. glucagon receptor has a role in maintenance of normal glycemia and postnatal regulation of islet and alpha and delta cell numbers PMID: 12552113
  23. glucagon were unaffected by the GLP-1 receptor antagonist exendin-(9-39) but abolished by des-His1-[Glu9]-glucagon-amide, a specific blocker of the glucagon receptor PMID: 15459251
  24. Glucagon signaling is required for normal beta-cell function and that insulin action is improved when disrupting the signal by glucagon receptor knockout. PMID: 17130493
  25. Blocking glucagon signalling by targeted Gcgr gene deletion leads to an improvement in metabolic control in this mouse model of streptozotocin-mediated beta cell loss and hyperglycaemia. PMID: 17131145
  26. Nestin expression is regulated by glucagon signaling. PMID: 17366624
  27. Glucagon receptor has a role in islet function in mice with insulin resistance PMID: 17479245
  28. Restoration of hepatic Gcgr expression in Gcgr-/- mice attenuated the development of hepatocellular injury. PMID: 18809404
  29. Gcgr receptor is required for control of lipid metabolism during the adaptive metabolic response to fasting. PMID: 19046568
  30. Oxyntomodulin, a glucagon receptor agonist, reverses obesity in diet-induced obese mice, and may be a novel therapeutic approach to the treatment of obesity. PMID: 19602537
  31. Increased pancreatic beta-cell expression of the Gcgr increased insulin secretion, pancreatic insulin content, beta-cell mass, and, when mice were fed a HFD, partially protected against hyperglycemia and IGT. PMID: 19602585
  32. These results suggest that GLP-1 may affect the maturation of postnatal but not prenatal beta cells. PMID: 19647035
  33. hepatic energy state is sensitive to glucagon receptor activation and requires PEPCK-C, thus providing new insights into liver metabolism. PMID: 19662685

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Expressed predominantly in liver, kidney, adrenal, lung and stomach, while lower levels of expression are detected in brown and white adipose tissue, cerebellum, duodenum and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*