Recombinant Mouse Glutathione-specific gamma-glutamylcyclotransferase 1 (Chac1)

In Stock
Code CSB-EP840285MO
Abbreviation Recombinant Mouse Chac1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Chac1
Uniprot No.
Research Area
Cell Biology
Alternative Names
Blocks Notch protein;Cation transport regulator-like protein 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-223aa
Target Protein Sequence
MKQESASQSTPPPSLSPAPSSAQPSWGDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDREGCTWGVAYQVRGEQVNEALKYLNVREAVLGGYDTKEVTFYPQDTPDQPLTALAYVATPQNPGYLGPAPEEVIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLEAIVDAVGTLLPCSYLPEQPLALT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.5 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide. Acts specifically on glutathione, but not on other gamma-glutamyl peptides. Glutathione depletion is an important factor for apoptosis initiation and execution. Acts as a pro-apoptotic component of the unfolded protein response pathway by mediating the pro-apoptotic effects of the ATF4-ATF3-DDIT3/CHOP cascade. Negative regulator of Notch signaling pathway involved in embryonic neurogenesis: acts by inhibiting Notch cleavage by furin, maintaining Notch in an immature inactive form, thereby promoting neurogenesis in embryos.
Gene References into Functions
  1. Study have shown that the 5' UTR of Chac1 plays an important role in expressing the full-length and short form of Chac1, and the expression level of Chac1 protein is predominantly regulated by its ubiquitination. PMID: 27302742
  2. Chac1 expression is detrimental to arsenite-treated cell survival and TRIB3 is critical for restraining the pro-death potential of Chac1 during arsenite stress. PMID: 27526673
  3. Data indicate that Chac1 protein expression was only detected in the presence of MG132, a proteasome inhibitor. PMID: 23615711
  4. The ChaC family is conversed across all phyla and represents a new pathway for glutathione degradation in living cells, and the first cytosolic pathway for glutathione degradation in mammalian cells. PMID: 23070364
Subcellular Location
Cytoplasm, cytosol. Golgi apparatus, trans-Golgi network.
Protein Families
Gamma-glutamylcyclotransferase family, ChaC subfamily
Tissue Specificity
Widely expressed, with high expression in forebrain and anterior spinal cord. Expressed at intermediate level in the dorsal aorta and heart. Present throughout adult brain (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*