Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Chac1

Uniprot No.

Q8R3J5

Research Area

Cell Biology

Alternative Names

Blocks Notch protein;Cation transport regulator-like protein 1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-223aa

Target Protein Sequence

MKQESASQSTPPPSLSPAPSSAQPSWGDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDREGCTWGVAYQVRGEQVNEALKYLNVREAVLGGYDTKEVTFYPQDTPDQPLTALAYVATPQNPGYLGPAPEEVIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLEAIVDAVGTLLPCSYLPEQPLALT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.5 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide. Acts specifically on glutathione, but not on other gamma-glutamyl peptides. Glutathione depletion is an important factor for apoptosis initiation and execution. Acts as a pro-apoptotic component of the unfolded protein response pathway by mediating the pro-apoptotic effects of the ATF4-ATF3-DDIT3/CHOP cascade. Negative regulator of Notch signaling pathway involved in embryonic neurogenesis: acts by inhibiting Notch cleavage by furin, maintaining Notch in an immature inactive form, thereby promoting neurogenesis in embryos.

Gene References into Functions

Study have shown that the 5' UTR of Chac1 plays an important role in expressing the full-length and short form of Chac1, and the expression level of Chac1 protein is predominantly regulated by its ubiquitination. PMID: 27302742
Chac1 expression is detrimental to arsenite-treated cell survival and TRIB3 is critical for restraining the pro-death potential of Chac1 during arsenite stress. PMID: 27526673
Data indicate that Chac1 protein expression was only detected in the presence of MG132, a proteasome inhibitor. PMID: 23615711
The ChaC family is conversed across all phyla and represents a new pathway for glutathione degradation in living cells, and the first cytosolic pathway for glutathione degradation in mammalian cells. PMID: 23070364

Subcellular Location

Cytoplasm, cytosol. Golgi apparatus, trans-Golgi network.

Protein Families

Gamma-glutamylcyclotransferase family, ChaC subfamily

Tissue Specificity

Widely expressed, with high expression in forebrain and anterior spinal cord. Expressed at intermediate level in the dorsal aorta and heart. Present throughout adult brain (at protein level).

Database Links

KEGG: mmu:69065

STRING: 10090.ENSMUSP00000028780

UniGene: Mm.35083

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP840285MO
Abbreviation	Recombinant Mouse Chac1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Glutathione-specific gamma-glutamylcyclotransferase 1 (Chac1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage