Recombinant Mouse Growth/differentiation factor 9 (Gdf9)

In Stock
Code CSB-EP009352MO
Abbreviation Recombinant Mouse Gdf9 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Gdf9
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
307-441aa
Target Protein Sequence
GQKAIRSEAKGPLLTASFNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPVHTMVQNIIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRCTCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for ovarian folliculogenesis.
Gene References into Functions
  1. The arginine residue in the pre-helix loop of GDF9 homodimer may prevent the inhibition from its pro-domain or directly alter receptor binding, but this residue in GDF9 does not significantly affect the heterodimer activity during heterodimer formation. PMID: 25253739
  2. A novel role for GDF9 in causing reproductive defects and suppressing tumor initiation in the Inha(-/-) mouse model. PMID: 23446452
  3. Embryo vitrification has no effect on ovarian morphology or expression of GDF9. PMID: 23141291
  4. The results show that chronic unpredictable stress suppresses GDF9 expression. PMID: 22205697
  5. GDF9 may contribute to the variation observed in follicular development, ovulation rate, and fecundity between mammals PMID: 22234469
  6. Data indicate that GDF-9 is absent in follicles of obese anovulatory/PCOS ovaries; upon treatment by heterotopic transplantation of gonadal adipose tissue from lean mice, expression of GDF-9 and ovulation appear to resume. PMID: 21557698
  7. E2 and oocyte-derived paracrine factors GDF9 and bone morphogenetic protein 15 coordinate to promote the development of cumulus cells PMID: 21047911
  8. GDF9-stimulated mitogenic activity in granulosa and cumulus cells is mediated through ERK1/2 activity. PMID: 20736313
  9. Intraovarian excess androgen in polycystic ovary syndrome may result in follicular arrest by down-regulating growth and differentiation factor-9 expression. PMID: 20032061
  10. Knockout of pentraxin 3, a downstream target of growth differentiation factor-9, causes female subfertility. PMID: 12040004
  11. GNCF-dependent repression of Gdf9 mediates gamete regulation of female fertility. PMID: 12912906
  12. Growing oocytes and GDF9 can each induce granulosa cells from secondary follicles to shift their phenotype toward that of mural granulosa cells. PMID: 14695909
  13. GDF9 appears to function indirectly to regulate early granulosa cell proliferation and theca recruitment in vivo PMID: 15016837
  14. the endogenous GDF9 protein is an important oocyte-secreted mitogen, but accounts for only part of total oocyte bioactivity. PMID: 15128595
  15. gremlin modulates the cross-talk between GDF9 and BMP signaling that is necessary during follicle development PMID: 15133038
  16. GDF9 is a key mediator of oocyte-enabled cumulus expansion in mice. PMID: 15385414
  17. Gdf9 has a role in the development and function of the oocyte-cumulus cell complex in mice. PMID: 15531364
  18. neither GDF9 nor TGFbeta alone, nor the two in unison, account for the critical oocyte-secreted factors regulating mouse cumulus expansion PMID: 15761035
  19. The E-box is a key regulatory sequence for Gdf9 expression in the ovary. PMID: 16495478
  20. The GDF9 immunostaining was exclusively seen in growing oocytes PMID: 16943361
  21. NOBOX directly regulates the transcription of Pou5f1 and Gdf9 in oocytes during early folliculogenesis PMID: 16997917
  22. Exogenous GDF9 during in vitro maturation(IVM) improved embryo development and fetal viability and provides a promising approach for human IVM. PMID: 17933754
  23. This study is the first characterization of purified biologically active human GDF9 and as such is of importance for studies on human fertility. PMID: 18162287
  24. Its promoter, stably transfected into XX mouse ES cells, showed increased expression by addition of leukemia inhibitory factor to the media. PMID: 18593614
  25. studies confirm GDF9 expression in the mouse testis, pituitary gland and adrenocortical cancer (AC) cells, and establish its expression in L beta T2 gonadotrophs, and in mouse adrenal glands, particularly foetal and neonatal cortical cells PMID: 19505950
  26. The highest Gdf9 mRNA levels were detected in oocytes in the pre-antral follicle stage. PMID: 19553355

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Tissue Specificity
Ovary.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*