Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)

In Stock
Code CSB-YP010048MO
Abbreviation Recombinant Mouse Guca2b protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Guca2b
Uniprot No.
Research Area
Others
Alternative Names
Guca2b; Guanylate cyclase activator 2B [Cleaved into: Uroguanylin; UGN)]
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
22-106aa
Target Protein Sequence
VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b) is produced in a yeast expression system and contains the full length of the mature protein, spanning amino acids 22-106. The protein carries an N-terminal 6xHis tag for easier purification and detection. SDS-PAGE analysis shows purity exceeding 90%, which appears suitable for various research applications and may provide reliable, consistent results.

Guanylate cyclase activator 2B (Guca2b) plays a key role in regulating the guanylate cyclase signaling pathway. It's involved in controlling cyclic GMP production, which likely influences various physiological processes. This function in the pathway makes Guca2b an important research target for studying cellular signaling and regulatory mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Yeast systems can support proper folding and some post-translational modifications for eukaryotic proteins, but Guca2b may require specific conformational features for its role in activating guanylate cyclase. The His tag is small and may not significantly interfere with folding. Still, without experimental validation (e.g., activity assays), the protein cannot be assumed to be correctly folded or bioactive. The high purity reduces impurities but does not guarantee functional conformation.

1. Protein-Protein Interaction Studies via His-Tag Pull-Down Assays

The His tag enables pull-down assays to identify potential binding partners, but if Guca2b is misfolded, interactions may be non-physiological. Validate any identified partners using native Guca2b from mouse tissues or confirm with complementary methods like co-immunoprecipitation. The high purity minimizes background but does not ensure biologically relevant interactions without folding validation.

2. Antibody Development and Validation

This recombinant Guca2b is suitable as an immunogen for antibody production, as antibodies can recognize linear epitopes even if the protein is misfolded. The high purity supports consistent immunization. However, antibodies generated may not bind to native, correctly folded Guca2b in physiological contexts. Validate antibody specificity against endogenous Guca2b from mouse samples.

3. His-Tag Based ELISA Development

The His tag facilitates ELISA development by allowing immobilization on nickel-coated plates. However, if Guca2b is misfolded, the assay may not accurately quantify native Guca2b in biological samples. Validate the ELISA with native Guca2b standards to ensure it measures physiological forms reliably.

4. Biochemical Characterization and Stability Studies

This application is feasible for basic biophysical analysis (e.g., thermal stability, pH tolerance). The yeast expression may provide relevant modifications, but data may not fully reflect native Guca2b without activity validation. Use the protein for stability studies, but interpret results cautiously in the context of potential folding issues.

Final Recommendation & Action Plan

Before using this recombinant Guca2b for functional studies, validate its folding and bioactivity through a guanylate cyclase activation assay or binding studies with its receptor. If active, proceed with interaction or ELISA applications; if inactive, limit use to antibody production or biochemical characterization, but always validate outcomes with native Guca2b. For reliable results, consider comparing with Guca2b expressed in mammalian systems for critical functional assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Gene References into Functions
  1. In obese mice UGN expression was decreased, whereas leptin treatment up-regulated UGN levels in duodenum in these genetically modified mice compared to WT. PMID: 25743370
  2. UGN exerts its inhibitory activity on the prendrin gene promoter likely via heat shock factor 1 action at a defined heat shock element site. PMID: 22129966
  3. findings establish a role for uroguanylin in an enteric-renal communication axis as well as a fundamental principle of this axis in the maintenance of salt homeostasis in vivo PMID: 14561709
  4. act on the mouse kidney, in part, through a cGMP-dependent, GC-C-independent mechanism, causing significant natriuresis by renal tubular processes. PMID: 14675035
  5. Role for uroguanylin in fluid homeostasis and as an integral component of a signaling mechanism that mediates changes in Na excretion in response to an enteral salt loading. PMID: 16819406

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Guanylin family
Tissue Specificity
Localized predominantly in intestinal villi and the corticomedullary junction of the kidney.
Database Links

KEGG: mmu:14916

STRING: 10090.ENSMUSP00000043203

UniGene: Mm.278

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*