Recombinant Mouse H-2 class I histocompatibility antigen, K-B alpha chain (H2-K1), partial

Code CSB-EP360792MO
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
H2-K1
Uniprot No.
Research Area
Immunology
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
22-305aa
Target Protein Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
38.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the presentation of foreign antigens to the immune system.
Gene References into Functions
  1. Major histocompatibility class I molecules H2-Kb and H2-Db proteins regulate sculpting of local cortical circuits and in their absence, the excess connectivity can function as a substrate for cortical plasticity throughout life. PMID: 25316337
  2. H-2Kb in an unfolded form to a post-endoplasmic reticulum compartment from where they can cycle back to the endoplasmic reticulum. PMID: 26714929
  3. tissue-specific h-2K(d) transgenic mice may be valuable tools for determining the mode of induction of CD8(+) T-cell responses. PMID: 23142461
  4. Analysis of CD8-positive T lymphocytes responsive to an H-2Kb-restricted immunodominant peptide displays T cell-homing patterns that support surveillance of both upper- and lower respiratory tract tissues by clonally related cells. PMID: 21690324
  5. Adult mice exposed to a noninherited maternal antigen accepts permanently H2-Kb-positive heart allografts despite the presence of normal levels of anti-K(b) T cell receptor transgenic T cells. PMID: 21178009
  6. Major histocompatibility class Ib-restricted CD8-positive T cells, in addition to H2-M3-restricted T cells, contribute to antilisterial immunity and may contribute to immune responses against other intracellular bacteria. PMID: 21098224
  7. The interaction of SHIP, 2B4 activating receptor, and the major histocompatibility complex influence the regulation of the natural killer (NK) cell receptor repertoire, cytolytic function, and interferon-gamma production. PMID: 20363967
  8. Data imply that a cognate linkage between TLR3 and MHC class I is required for efficient CTL priming to HSV-1. PMID: 20124105
  9. Endoplasmic reticulum aminopeptidase (ERAAP)-deficiency changes the antigen processing mechanism and causes a marked increase in the length of peptides normally presented by the histocompatibility class I-peptide binding groove. PMID: 20173027
  10. Data provide biological confirmation that the chromosome 6 QTL provided MCMV control independent of H-2(k) via NK cells. PMID: 19820922
  11. showed that a large disulfide-bonded complex was present in the mouse cells that included ERp57, tapasin, and K(d). PMID: 19687800
  12. Analysis of structure and function relationships of an autoantigenic peptide of insulin bound to H-2K(d) that stimulates CD8 T cells in insulin-dependent diabetes mellitus. PMID: 11943852
  13. intramembrane mechanism by which unassembled H2Kb molecules are retained in the endoplasmic reticulum of fibroblasts PMID: 12006653
  14. The H2-K(b) gene belongs to target genes of the NF-IL6 (C/EBPbeta) in the course of the cellular response to TNF-alpha. Some consequences of this are discussed in a general framework of inducible expression of the H2-K(b) gene. PMID: 12184911
  15. linked mhc polymorphism-driven diversification of the cytotoxic T lymphocyte repertoire to the generation of high-avidity, protective antiviral T cells and to superior antiviral defense PMID: 12459592
  16. crystal structure complexed with an HBV-core nonapeptide PMID: 15272181
  17. signaling through the mouse NK inhibitory receptor Ly49C requires the presence of H-2Kb and this signaling is prevented when H-2Kb is ablated by pulsing with a peptide that can bind to it with high affinity PMID: 16148097
  18. two H-2K(k)-peptide complexes provide insights into the mechanisms through which MHC polymorphism outside primary peptide pockets influences the conformation of the bound peptides and have implications for TCR recognition PMID: 16148128
  19. Linkage analysis performed in F(2) backcross ([BALB/c x C3H/HeN] x BALB/c) mice carrying the H2(k) region confirmed the presence of a susceptibility locus within the H2 region on proximal chromosome 17. PMID: 16148132
  20. analysis of K(d)-restricted antigen presentation and recognition events PMID: 16473882
  21. These results demonstrate that Ly49Q efficiently binds H-2K(b) ligand. PMID: 17240452
  22. Study presents the 2.35 A structure of the 2C TCR complexed with its foreign ligand H-2L(d)-QL9; surprisingly, TCR utilizes a different strategy to engage the foreign pMHC in comparison to the manner in which it recognizes a self ligand H-2K(b)-dEV8. PMID: 17418792
  23. Naive polyclonal class Ib-restricted CD8-positive T cells have the ability to homeostatically expand in the periphery in a largely class Ib-dependent manner. PMID: 18292501
  24. the mHpa398 and mHpa519 peptides are novel H-2K(b)-restricted CTL epitopes capable of inducing heparanase-specific CTLs in vitro and in vivo PMID: 18316618
  25. an unsuspected role for the MHC-I-Ly49 interaction in the development and function of the brain. PMID: 18453559
  26. data suggest that APLP2 modulates the stability and endocytosis of K(d) molecules PMID: 18641335
  27. Ethanol-elicited reduction in proteasome activity contributes to the suppression of SIINFEKL-H2Kb presentation on the surface of liver cells. PMID: 19195028
  28. These physiological and behavioral phenotypes in K(b)D(b-/-) mice reveal a surprising role for classical MHCI molecules in synaptic plasticity and motor learning. PMID: 19346486
  29. the MHC class I D locus prompts expansion and activation of Ly49G2(+) NK cells that are needed in H-2(k) MCMV resistance. PMID: 19454713
  30. comparison of the consequences of MHC overexpression in muscle at different ages;a markedly more severe disease phenotype in young mice, with rapid onset of muscle weakness and pathology PMID: 19700752
  31. H2-Kb and H2-Db ligands, signaling via neuronal class I histocompatibility antigen receptors, may enable activity-dependent remodeling of brain circuits during developmental critical periods. PMID: 19945389

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
MHC class I family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*