Recombinant Mouse Histone H2B type 1-A (Hist1h2ba)

In Stock
Code CSB-EP010401MO
Abbreviation Recombinant Mouse Hist1h2ba protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Hist1h2ba
Uniprot No.
Research Area
Others
Alternative Names
H2bc1; Hist1h2ba; Th2b; Histone H2B type 1-A; Histone H2B; testis; Testis-specific histone H2B
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
2-127aa
Target Protein Sequence
PEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Histone H2B type 1-A (Hist1h2ba) is expressed in E.coli and covers the full length of the mature protein (2-127aa). The construct includes an N-terminal 10xHis tag and a C-terminal Myc tag, which help with purification and detection. SDS-PAGE analysis shows the protein reaches greater than 85% purity, suggesting it's well-suited for research work.

Histone H2B appears to be a core component of the nucleosome and likely plays an important role in how chromatin gets organized and compacted inside the cell nucleus. The protein participates in nucleosome formation - something that seems fundamental to DNA packaging and regulation. Research involving chromatin dynamics, gene expression control, and epigenetic changes often relies on this protein, since understanding these cellular processes at the molecular level may require it.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The mouse Histone H2B is a core histone that requires correct folding and specific interactions with other histones (H2A, H3, H4) and DNA to form functional nucleosomes. While E. coli can express histones, the dual tags at both termini may interfere with native folding and assembly, as the N- and C-terminal regions of H2B are critical for histone-histone interactions and nucleosome stability. The tags could sterically hinder proper dimerization with H2A or integration into the histone octamer. Although histones are generally stable proteins, the presence of tags and the lack of eukaryotic post-translational modifications (e.g., acetylation) may affect bioactivity. Without experimental validation (e.g., nucleosome reconstitution assays or circular dichroism), it is uncertain whether the protein is correctly folded or bioactive. Therefore, correct folding and bioactivity cannot be assumed and must be verified.

1. Chromatin Reconstitution and Nucleosome Assembly Studies

If the recombinant H2B is verified to fold and assemble correctly with other histones (e.g., through nucleosome reconstitution assays), it can be used for chromatin studies. However, the dual tags may disrupt histone-histone interactions or DNA binding, leading to inefficient nucleosome formation. Results should be validated with tag-free histones to ensure physiological relevance. The tags facilitate purification but may introduce artifacts.

2. Histone-Protein Interaction Studies

This recombinant H2B may be used in pull-down assays to identify binding partners, leveraging the tags for immobilization and detection. However, misfolding or tag-mediated non-specific binding could yield false positives/negatives. Interactions identified must be confirmed with native H2B (e.g., from eukaryotic sources) to ensure they reflect physiological associations.

3. Antibody Development and Validation

This recombinant H2B can serve as an immunogen for antibody production, as antibodies often recognize linear epitopes. The high purity supports consistent immunization and screening. However, antibodies generated may not bind to native H2B in chromatin due to conformational changes caused by tags or misfolding. Validation against tag-free, native H2B is essential for applications like immunofluorescence or ChIP.

4. Biochemical Characterization and Structural Studies

The protein is suitable for basic biophysical analyses (e.g., circular dichroism to assess secondary structure, dynamic light scattering to monitor aggregation). However, for high-resolution structural studies (e.g., X-ray crystallography), the tags may interfere with crystal formation or native conformation. Tag removal is recommended for meaningful structural insights. These assays can help evaluate folding status but not guarantee native structure.

Final Recommendation & Action Plan

Before using this recombinant H2B for functional applications, validate its folding and assembly capability through biophysical and functional tests. Start with circular dichroism to check for expected α-helical content, and perform nucleosome reconstitution assays with other core histones to confirm it can form stable complexes. If activity is verified, proceed with interaction or structural studies; otherwise, limit use to non-functional applications like antibody production, but always validate outcomes with native H2B. For reliable chromatin studies, consider using tag-free histones expressed in eukaryotic systems or cleaving the tags enzymatically. Avoid assumptions about bioactivity without experimental confirmation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Variant histone specifically required to direct the transformation of dissociating nucleosomes to protamine in male germ cells. Entirely replaces classical histone H2B prior nucleosome to protamine transition and probably acts as a nucleosome dissociating factor that creates a more dynamic chromatin, facilitating the large-scale exchange of histones. In condensing spermatids, the heterodimer between H2AB1 and H2BC1/TH2B is loaded onto the nucleosomes and promotes loading of transition proteins (TNP1 and TNP2) onto the nucleosomes. Inclusion of the H2AB1-H2BC1/TH2B dimer into chromatin opens the nucleosomes, releasing the nucleosomal DNA ends and allowing the invasion of nucleosomes by transition proteins (TNP1 and TNP2). Then, transition proteins drive the recruitment and processing of protamines, which are responsible for histone eviction. Also expressed maternally and is present in the female pronucleus, suggesting a similar role in protamine replacement by nucleosomes at fertilization. Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Gene References into Functions
  1. demonstrate an actin-driven differential modulation of core histone H2B and heterochromatin HP1alpha protein dynamics with chromatin PMID: 26359759
  2. TH2B is a unique histone variant that plays a key role in the histone-to-protamine packing of the male genome and guides genome-wide chromatin transitions that both precede and follow transmission of the male genome to the egg. PMID: 23884607
  3. MAP3K4/CBP-regulated acetylation controls epithelial-mesenchymal transition in trophoblast stem cells PMID: 21549327
Subcellular Location
Nucleus. Chromosome.
Protein Families
Histone H2B family
Tissue Specificity
Mainly expressed in testis, and the corresponding protein is also present in mature sperm. Also present in metaphase oocytes (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*