Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Nkx3-2

Uniprot No.

P97503

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

Nkx3-2; Bapx1; Nkx-3.2; Nkx3bHomeobox protein Nkx-3.2; Bagpipe homeobox protein homolog 1; Homeobox protein NK-3 homolog B

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-333aa

Target Protein Sequence

MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.2kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The synthesis of the recombinant plasmid containing the gene encoding the Mouse Nkx3-2 protein (1-333aa) is the first step to produce the recombinant Mouse Nkx3-2 protein. After that, the recombinant plasmid is transformed into e.coli cells. e.coli cells capable of enduring a specific antibiotic are selected, demonstrating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions that encourage the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is linked to the protein. Following expression, affinity purification is employed to isolate and purify the recombinant Mouse Nkx3-2 protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Mouse Nkx3-2 protein, indicating a purity level exceeding 90%.

Target Background

Function

Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.

Gene References into Functions

these results suggest that Nkx3.2-mediated HIF regulation may allow cartilage-specific avascularity under hypoxic conditions during endochondral skeleton development. PMID: 28479297
that cartilage-specific and Cre-dependent Nkx3.2 overexpression in mice results in significant postnatal dwarfism in endochondral skeletons PMID: 27253464
Nkx3.2 promotes primary chondrogenesis by two mechanisms: Direct and Sox9-independent upregulation of Col2a1 transcription and upregulation of Sox9 mRNA expression under positive feedback system. PMID: 22511961
the balance of Pax3, Nkx3.2 and Sox9 may act as a molecular switch during the chondrogenic differentiation of muscle progenitor cells, which may be important for fracture healing. PMID: 22768305
These results demonstrated that Nkx3.2-dependent suppression of Runx2 was a crucial factor in hypoxia-dependent maintenance of chondrocyte identity. PMID: 22093831
Data show that IkappaB kinase beta (IKKbeta) can be activated in the nucleus by Nkx3.2 in the absence of exogenous IKK-activating signals, allowing constitutive nuclear degradation of IkappaB-alpha. PMID: 21606193
Targeted disruption of the Nkx3.2 (Bapx1) gene in mice results in limited defects of chondrocranial bones and the axial skeleton, particularly pronounced in cervical vertebrae. PMID: 12204261
Pax1 and Pax9 can transactivate regulatory sequences in the Bapx1 promoter to induce chondrogenic differentiation in the sclerotome. PMID: 12490554
Nkx3.2 has a critical role in the induction of somitic chondrogenesis PMID: 12746429
Data show that Meox1 activates the Bapx1 promoter in a dose-dependent manner and that this activity is enhanced in the presence of Pax1 and/or Pax9. PMID: 15024065
in the Bapx1 mutant embryo, Fgf10 expression is downregulated and the dorsal pancreas remains at the midline PMID: 15329346
Nkx3.2 represses expression of the chondrocyte maturation factor Runx2, and Runx2 mis-expression can rescue the Nkx3.2-induced blockade of chondrocyte maturation. PMID: 16421188
Bapx1 overexpression generates limb anteroposterior patterning defects including induction of Shh signaling and ectopic activation of functions downstream of Shh signaling into the anterior region of the autopod. PMID: 16791844
Bapx1 plays a crucial organizing role effecting position and separation of the spleen and pancreas to prevent metaplastic transformation PMID: 16912273
Nkx3.2 supports chondrocyte survival by constitutively activating RelA. PMID: 17310243
A regulatory mutation, (-519G-->A) within the neu1 promoter generates a consensus binding site for Nkx3 family transcription repressors. PMID: 19217813
Results reveal that the molecular pathway modulated by Bapx1 links two major regulators in chondrogenesis, Sox9 and Runx2, to coordinate skeletal formation. PMID: 19306868

Hide All

Subcellular Location

Nucleus.

Protein Families

NK-3 homeobox family

Tissue Specificity

Expressed widely in mesoderm at the gastroduodenal junction (at protein level). Expressed in visceral mesoderm and embryonic skeleton. Expression is restricted to immature proliferative chondrocytes during endochondral ossification.

Database Links

KEGG: mmu:12020

STRING: 10090.ENSMUSP00000051990

UniGene: Mm.2530

Code	CSB-EP015849MOb1
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage