Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP015849MOe1 |
| Product Type | Recombinant Protein |
| Size | US$2632 |
| Uniprot No. | P97503 |
| Relevance | Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog B |
| Species | Mus musculus (Mouse) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ |
| Research Area | Epigenetics and Nuclear Signaling |
| Source | E.coli |
| Gene Names | Nkx3-2 |
| Expression Region | 1-333aa |
| Tag Info | Tag-Free |
| Mol. Weight | 35.2kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus. |
| Subcellular Location | Nucleus |
| Protein Families | NK-3 homeobox family |
| Tissue Specificity | Expressed widely in mesoderm at the gastroduodenal junction (at protein level). Expressed in visceral mesoderm and embryonic skeleton. Expression is restricted to immature proliferative chondrocytes during endochondral ossification. |
| Database Links |
KEGG: mmu:12020 STRING: 10090.ENSMUSP00000051990 UniGene: Mm.2530 |
Nkx3-2 Antibodies for Mus musculus (Mouse)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA015849ZA01MO | Nkx3-2 Antibody | Mus musculus | ELISA, WB (ensure identification of antigen) |
| CSB-PA015849ZA01MO | Nkx3-2 Antibody | Mus musculus | ELISA, WB (ensure identification of antigen) |
| CSB-PA015849ZA01MO | Nkx3-2 Antibody | Mus musculus | ELISA, WB (ensure identification of antigen) |
Nkx3-2 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP015849MO CSB-BP015849MO CSB-MP015849MO |
Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2) | Yeast Baculovirus Mammalian cell |
| CSB-EP015849MOb2 | Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2) | E.coli |
| CSB-EP015849MOb1 | Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2) | E.coli |
| CSB-EP015849HU | Recombinant Human Homeobox protein Nkx-3.2(Nkx3-2) | E.coli |
| CSB-EP015849MO | Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2),Escherichia Coli | E.coli |
Recombinant Dog Interleukin-8(IL8)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human Ras-related protein Rab-5C(RAB5C)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Apolipoprotein B-100(APOB),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Protein-methionine sulfoxide oxidase MICAL2(MICAL2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
