Name: Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)
Brand: CUSABIO
SKU: CSB-EP015849MOe1

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	Nkx3-2
Uniprot No.	P97503
Research Area	Epigenetics and Nuclear Signaling
Alternative Names	Nkx3-2; Bapx1; Nkx-3.2; Nkx3bHomeobox protein Nkx-3.2; Bagpipe homeobox protein homolog 1; Homeobox protein NK-3 homolog B
Species	Mus musculus (Mouse)
Source	E.coli
Expression Region	1-333aa
Target Protein Sequence	MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	35.2kDa
Protein Length	Full Length
Tag Info	Tag-Free
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Data

Function	Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Gene References into Functions	these results suggest that Nkx3.2-mediated HIF regulation may allow cartilage-specific avascularity under hypoxic conditions during endochondral skeleton development. PMID: 28479297 that cartilage-specific and Cre-dependent Nkx3.2 overexpression in mice results in significant postnatal dwarfism in endochondral skeletons PMID: 27253464 Nkx3.2 promotes primary chondrogenesis by two mechanisms: Direct and Sox9-independent upregulation of Col2a1 transcription and upregulation of Sox9 mRNA expression under positive feedback system. PMID: 22511961 the balance of Pax3, Nkx3.2 and Sox9 may act as a molecular switch during the chondrogenic differentiation of muscle progenitor cells, which may be important for fracture healing. PMID: 22768305 These results demonstrated that Nkx3.2-dependent suppression of Runx2 was a crucial factor in hypoxia-dependent maintenance of chondrocyte identity. PMID: 22093831 Data show that IkappaB kinase beta (IKKbeta) can be activated in the nucleus by Nkx3.2 in the absence of exogenous IKK-activating signals, allowing constitutive nuclear degradation of IkappaB-alpha. PMID: 21606193 Targeted disruption of the Nkx3.2 (Bapx1) gene in mice results in limited defects of chondrocranial bones and the axial skeleton, particularly pronounced in cervical vertebrae. PMID: 12204261 Pax1 and Pax9 can transactivate regulatory sequences in the Bapx1 promoter to induce chondrogenic differentiation in the sclerotome. PMID: 12490554 Nkx3.2 has a critical role in the induction of somitic chondrogenesis PMID: 12746429 Data show that Meox1 activates the Bapx1 promoter in a dose-dependent manner and that this activity is enhanced in the presence of Pax1 and/or Pax9. PMID: 15024065 in the Bapx1 mutant embryo, Fgf10 expression is downregulated and the dorsal pancreas remains at the midline PMID: 15329346 Nkx3.2 represses expression of the chondrocyte maturation factor Runx2, and Runx2 mis-expression can rescue the Nkx3.2-induced blockade of chondrocyte maturation. PMID: 16421188 Bapx1 overexpression generates limb anteroposterior patterning defects including induction of Shh signaling and ectopic activation of functions downstream of Shh signaling into the anterior region of the autopod. PMID: 16791844 Bapx1 plays a crucial organizing role effecting position and separation of the spleen and pancreas to prevent metaplastic transformation PMID: 16912273 Nkx3.2 supports chondrocyte survival by constitutively activating RelA. PMID: 17310243 A regulatory mutation, (-519G-->A) within the neu1 promoter generates a consensus binding site for Nkx3 family transcription repressors. PMID: 19217813 Results reveal that the molecular pathway modulated by Bapx1 links two major regulators in chondrogenesis, Sox9 and Runx2, to coordinate skeletal formation. PMID: 19306868 Show More Hide All
Subcellular Location	Nucleus
Protein Families	NK-3 homeobox family
Tissue Specificity	Expressed widely in mesoderm at the gastroduodenal junction (at protein level). Expressed in visceral mesoderm and embryonic skeleton. Expression is restricted to immature proliferative chondrocytes during endochondral ossification.
Database Links	KEGG: mmu:12020 STRING: 10090.ENSMUSP00000051990 UniGene: Mm.2530

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP015849MOe1
Size	US$2632
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)

Product Details

Related Products

Target Data

Most popular with customers

CloseMessage

×CloseMessage