Recombinant Mouse Inhibin beta B chain (Inhbb)

Code CSB-MP011720MO
Abbreviation Recombinant Mouse Inhbb protein
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Activin beta-B chain
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
297-411aa
Target Protein Sequence
GLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Gene References into Functions
  1. Inflammatory stimuli strongly induce Smad2 and Smad5 phosphorylation in wild-type mice. None of these Smad effectors are activated in mice deficient in activin B. Activin B, whose messenger RNA expression is strongly induced after LPS administration or E coli infection, is required for activation of Smad1/5/8 signaling. Hepcidin expression did not depend on activin B expression. PMID: 27903526
  2. Menin binds on the promoter of Inhbb gene where it favours the recruitment of Ezh2 via an indirect mechanism involving Akt-phosphorylation. PMID: 28215965
  3. Data suggest Inhbb is physiologically essential for early folliculogenesis; Inhbb appears to participate in regulation of cell cycle progression, apoptosis, and steroidogenesis (estradiol/progesterone synthesis) in ovarian granulosa cells in culture. PMID: 26063610
  4. Activin B, a transforming growth factor beta - related ligand, is upregulated during tumorigenesis and drives the loss of insulin expression and beta-cell maturity in a mouse insulinoma model. PMID: 26711255
  5. in mammalian spinal cord, Tgfbeta ligands and ActB together support oligodendrocyte development and myelin formation PMID: 24917498
  6. There is a dramatic induction of Inhbb mRNA, encoding the activin beta(B)-subunit, in liver challenged with lipopolysaccharide, slightly preceding an increase in Smad1/5/8 phosphorylation and Hamp mRNA. PMID: 22611157
  7. the transition between stem cells and committed progenitors is neither sharp nor irreversible and GDF11, ACTbetaB and FST are crucial components of a circuit that controls both total cell number and the ratio of neuronal versus glial cells in this system PMID: 21852401
  8. Maintenance of female germ cells hinge upon a delicate balance between positive (WNT4 and beta-catenin) and negative (activin betaB) regulators derived from the somatic cells in the fetal ovary. PMID: 20454446
  9. Inhbb-deficient mice have failure of eyelid fusion at birth and demonstrate more severe effects on somatic growth and survival. PMID: 14551263
  10. Activin affects both stromal cells and keratinocytes in normal and wounded skin, and the effect on keratinocytes is dose-dependent in vivo. PMID: 16127153
  11. ALK7 plays an important role in regulating the functional plasticity of pancreatic islets, negatively affecting beta-cell function by mediating the effects of activin B on Ca(2+) signaling PMID: 18480258

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Tissue Specificity
Uterus, testis, ovary, lung, kidney, brain, CJ7 embryonic stem cells, and possibly in liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*