Recombinant Mouse Interleukin-1 family member 10(Il1f10)

Code CSB-YP837144MO
Product Type Recombinant Protein
Size US$2474
Uniprot No. Q8R459
Abbreviation Il1f10
Relevance Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2 (By similarity).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias IL-1F10
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
Research Area Others
Source Yeast
Gene Names Il1f10
Protein Names Recommended name: Interleukin-1 family member 10 Short name= IL-1F10
Expression Region 1-152aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2 (By similarity).
Subcellular Location Secreted
Protein Families IL-1 family
Database Links

KEGG: mmu:215274

STRING: 10090.ENSMUSP00000063004

UniGene: Mm.218750

Q&A and Customer Reviews

Q&A
Q:

Can you confirm the following information about CSB-YP837144MO:
Does the product contain any human side products?
Does the product contain any animal side products?
Does the product contain any infectious materials including HIV/AIDS and HCV/HBV?

A:
Thanks for your inquiry.
1) This product does not contain any human side products.
2) This product does not contain any animal side products.
3) This product does not contain any infectious materials including HIV/AIDS and HCV/HBV.
We can send you the Animal-Free Declaration through email if you need.
Customer Reviews

Related Products

Il1f10 Antibodies

Il1f10 Antibodies for Mus musculus (Mouse)

Il1f10 Proteins

Il1f10 Proteins for Mus musculus (Mouse)

Il1f10 ELISA Kit

Il1f10 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.