Name: Recombinant Mouse Interleukin-1 family member 10 (Il1f10)
Brand: CUSABIO
SKU: CSB-YP837144MO

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Il1f10

Uniprot No.

Q8R459

Research Area

Others

Alternative Names

Il1f10Interleukin-1 family member 10; IL-1F10

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

1-152aa

Target Protein Sequence

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

19.1kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Can you confirm the following information about CSB-YP837144MO:
Does the product contain any human side products?
Does the product contain any animal side products?
Does the product contain any infectious materials including HIV/AIDS and HCV/HBV?

Thanks for your inquiry.
1) This product does not contain any human side products.
2) This product does not contain any animal side products.
3) This product does not contain any infectious materials including HIV/AIDS and HCV/HBV.
We can send you the Animal-Free Declaration through email if you need.

Target Background

Function

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.

Gene References into Functions

Il-38-deficiency did not impact the development or resolution of Imiquimod-induced skin inflammation. PMID: 29554104
IL-38 overexpression attenuates the severity of experimental arthritis. IL-38 may exert its anti-inflammatory effects by decreasing the production of proinflammatory cytokines by macrophages and synovial fibroblasts. PMID: 28288964

Subcellular Location

Cytoplasm. Endoplasmic reticulum-Golgi intermediate compartment. Secreted.

Protein Families

IL-1 family

Database Links

KEGG: mmu:215274

STRING: 10090.ENSMUSP00000063004

UniGene: Mm.218750

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address