Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22)

In Stock
Code CSB-EP325391MO
Abbreviation Recombinant Mouse Klk1b22 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Klk1b22
Uniprot No.
Research Area
Others
Alternative Names
Klk1b22; Klk-22; Klk22; Kallikrein 1-related peptidase b22; EC 3.4.21.35; Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP A; Glandular kallikrein K22; mGK-22; Nerve growth factor beta chain endopeptidase; Tissue kallikrein 22
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
25-259aa
Target Protein Sequence
ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) gets produced in an E.coli expression system and contains amino acids 25-259 of the mature protein. The protein comes with an N-terminal 6xHis-SUMO tag, which makes purification and solubility much more manageable. SDS-PAGE analysis shows it reaches over 90% purity - pretty solid for most research work.

Klk1b22 belongs to the kallikrein-related peptidase family, a group known for proteolytic activity across different physiological processes. These enzymes appear to play important roles in inflammation pathways, blood pressure regulation, and tissue remodeling. Though the functional dynamics of Klk1b22 may provide insights into these critical biological processes, much about its specific role remains to be fully understood.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Immunoassay Optimization

This recombinant Klk1b22 protein works well as an immunogen for creating specific antibodies against mouse kallikrein 1-related peptidase b22. That N-terminal 6xHis-SUMO tag makes purification straightforward and helps with immobilization during antibody screening assays. The >90% purity should be sufficient for producing decent antibodies with minimal cross-reactivity issues. Researchers could then use these antibodies in Western blotting, immunoprecipitation, or ELISA-based detection systems when studying Klk1b22 expression in mouse tissues and cell lines.

2. Protein-Protein Interaction Studies Using Tag-Assisted Pull-Down Assays

That N-terminal 6xHis-SUMO tag opens up possibilities for metal affinity-based pull-down experiments to hunt for potential binding partners of Klk1b22. Scientists can immobilize the protein on nickel-charged resin, then incubate it with mouse tissue lysates or cell extracts to capture whatever might be interacting. Mass spectrometry analysis of co-precipitated proteins could help map the Klk1b22 interactome. This approach seems particularly useful since the biological activity hasn't been tested yet - interaction studies might offer a more practical research direction.

3. Biochemical Characterization and Stability Studies

This recombinant protein gives researchers a standardized tool for investigating Klk1b22's biochemical properties, including thermal stability, pH tolerance, and buffer compatibility. Teams can run differential scanning fluorimetry, dynamic light scattering, and analytical size exclusion chromatography to characterize protein folding and aggregation behavior. The mature protein region (25-259aa) expressed in E.coli allows for cost-effective production of the material needed for extensive biochemical profiling experiments.

4. Comparative Structural and Functional Analysis Within Kallikrein Family

The recombinant Klk1b22 proves useful in comparative studies alongside other kallikrein family members to understand evolutionary relationships and structural differences. Cross-reactivity studies with antibodies raised against related kallikreins may provide insights into conserved epitopes and antigenic regions. The protein can also serve as a negative control in enzymatic assays designed for other kallikrein family members, which helps establish specificity profiles for various substrates and inhibitors.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Protein Families
Peptidase S1 family, Kallikrein subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*