Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22)

In Stock
Code CSB-EP325391MO
Abbreviation Recombinant Mouse Klk1b22 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Klk1b22
Uniprot No.
Research Area
Others
Alternative Names
Klk1b22; Klk-22; Klk22; Kallikrein 1-related peptidase b22; EC 3.4.21.35; Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP A; Glandular kallikrein K22; mGK-22; Nerve growth factor beta chain endopeptidase; Tissue kallikrein 22
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
25-259aa
Target Protein Sequence
ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) gets produced in an E.coli expression system and contains amino acids 25-259 of the mature protein. The protein comes with an N-terminal 6xHis-SUMO tag, which makes purification and solubility much more manageable. SDS-PAGE analysis shows it reaches over 90% purity - pretty solid for most research work.

Klk1b22 belongs to the kallikrein-related peptidase family, a group known for proteolytic activity across different physiological processes. These enzymes appear to play important roles in inflammation pathways, blood pressure regulation, and tissue remodeling. Though the functional dynamics of Klk1b22 may provide insights into these critical biological processes, much about its specific role remains to be fully understood.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Immunoassay Optimization

This recombinant Klk1b22 serves as an excellent immunogen for generating specific antibodies against mouse kallikrein 1-related peptidase b22. The full-length mature protein sequence (25-259aa) ensures comprehensive epitope coverage, and the high purity (>90%) minimizes antibodies against contaminants. The His-SUMO tag facilitates purification and immobilization during antibody screening and validation in ELISA, Western blot, or immunoprecipitation assays.

2. Protein-Protein Interaction Studies Using Tag-Assisted Pull-Down Assays

The E.coli expression system may not provide the post-translational modifications and the correct folding environment required for eukaryotic proteins, especially for proteases, which may require specific disulfide bond formation and conformation. SUMO tags may improve solubility, but they cannot guarantee functional folding. Therefore, the probability of this protein folding correctly and being active is relatively low and requires experimental verification. If correctly folded, the protein could identify physiological binding partners. However, a misfolded Klk1b22 may expose hydrophobic regions, leading to non-specific (false-positive) binding or failing to present genuine interaction interfaces, causing false negatives. The large SUMO tag may sterically hinder binding sites. Data interpretation would be challenging without validation using a natively folded protein.

3. Biochemical Characterization and Stability Studies

This is the essential first step to assess the protein's physical properties and folding state. Techniques like size-exclusion chromatography with multi-angle light scattering (SEC-MALS) can determine oligomeric state and homogeneity, while circular dichroism (CD) spectroscopy can analyze secondary structure content and thermal stability. These studies provide critical quality control data for evaluating the protein's suitability for functional applications.

4. Comparative Structural and Functional Analysis Within the Kallikrein Family

This protein can be used for sequence-based comparisons and immunological cross-reactivity studies with other kallikrein family members. However, comparative functional analyses (e.g., enzymatic activity or substrate specificity) would be invalid without confirmed native folding and activity. Structural comparisons via Western blotting or epitope mapping are feasible. It is useful for non-functional comparative studies, but functional analyses require a properly folded and active enzyme.

Final Recommendation & Action Plan

The recombinant Klk1b22 is reliable for antibody development and biochemical characterization but requires rigorous validation for functional studies due to uncertainties in folding and activity. The immediate priority is Application 3 (Biochemical Characterization) to assess protein folding, stability, and oligomeric state through SEC-MALS and CD spectroscopy. If the protein demonstrates monodisperse behavior and structured spectra, proceed to validate enzymatic activity using specific substrates. Once activity is confirmed, Applications 2 and 4 (functional aspects) can be considered. Application 1 (Antibody Development) can proceed immediately regardless of folding status. Without activity validation, limit use to non-functional applications to avoid misleading results. This systematic approach ensures reliable data interpretation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Protein Families
Peptidase S1 family, Kallikrein subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*