Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Kcp

Uniprot No.

Q3U492

Research Area

Cell Biology

Alternative Names

Kcp; Crim2; Kcp1; Kielin/chordin-like protein; Cysteine-rich BMP regulator 2; Cysteine-rich motor neuron 2 protein; CRIM-2; Kielin/chordin-like protein 1; KCP-1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1085-1425aa

Target Protein Sequence

QALSNCTEDLVGSELVPPDPCYTCQCQDLTWLCTHRACPELSCPLWERHTTPGSCCPVCKDPTQSCMHQGRWVASGEQWAVDACTSCSCVAGTVHCQTQRCRKLACSRDEVPALSPGSCCLRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGEDFSVHVTNDDRGRRGVAWTQEVAVLLGTVAVRLLQGRTVMVDQHTVTLPFLREPLLYIELRGHTVILHAQPGLQVLWDGQSQVEVRVPSSYRGQTCGLCGNFNGFAQDDLQGPDGRLLPTEASFGNSWKVPKGLGPGRPCSAGREVDPCRAAGYRARREANARCGILKTSPFSHCHAV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

44.7 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1085-1425 form the expressed segment for recombinant Mouse Kcp. The theoretical molecular weight of the Kcp protein is 44.7 kDa. Expression of this Kcp protein is conducted in e.coli. The Kcp gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Kcp protein during the following stages.

The mouse kielin/chordin-like protein (Kcp) is renowned for its regulatory effects on bone morphogenetic proteins (BMPs). Expressed across all stages of embryonic development, Kcp is particularly prominent in renal tubules within the kidney cortex, with no presence in the nephrogenic zone. Kcp suppresses the TGF-β1 signaling pathway. Kcp exhibits dual effects on different cytokines, enhancing BMPs while suppressing others, including TGF-β or activin. Studies have shown that Kcp can protect against unilateral ureteral obstruction (UUO)-induced renal fibrosis by regulating BMP7 expression. Kcp can also mitigate nonalcoholic fatty liver disease via modulating BMP4 and TGF-β1.

Target Background

Function

Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways.

Gene References into Functions

Metabolic profiling indicated increased energy expenditure in KCP-overexpressing mice and reduced expenditure in the KCP mutants with no effect on food intake or activity. These findings demonstrate that shifting the TGF-beta superfamily signaling with a secreted protein can alter the physiology and thermogenic properties of adipose tissue to reduce obesity even when mice are fed a high-fat diet. PMID: 28424263
These data suggest that extracellular regulation of the TGF-beta/BMP signaling axis by KCP, and by extension possibly other cysteine-rich domain proteins, can attenuate both acute and chronic renal injury. PMID: 23539757
The data indicate an important role for KCP in attenuating the pathology of renal fibrotic disease. PMID: 15793581
role for KCP in modulating the responses between these anti- and profibrotic cytokines in the initiation and progression of renal interstitial fibrosis PMID: 16738323

Subcellular Location

Secreted.

Tissue Specificity

Weakly expressed in embryonic kidney and brain. Not expressed in adult tissues and several cell lines.

Database Links

KEGG: mmu:333088

STRING: 10090.ENSMUSP00000099135

UniGene: Mm.332961

Code	CSB-EP012103MO
Abbreviation	Recombinant Mouse Kcp protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Kielin/chordin-like protein (Kcp), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage