Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Kcp; Crim2; Kcp1; Kielin/chordin-like protein; Cysteine-rich BMP regulator 2; Cysteine-rich motor neuron 2 protein; CRIM-2; Kielin/chordin-like protein 1; KCP-1
Species
Mus musculus (Mouse)
Expression Region
1085-1425aa
Target Protein Sequence
QALSNCTEDLVGSELVPPDPCYTCQCQDLTWLCTHRACPELSCPLWERHTTPGSCCPVCKDPTQSCMHQGRWVASGEQWAVDACTSCSCVAGTVHCQTQRCRKLACSRDEVPALSPGSCCLRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGEDFSVHVTNDDRGRRGVAWTQEVAVLLGTVAVRLLQGRTVMVDQHTVTLPFLREPLLYIELRGHTVILHAQPGLQVLWDGQSQVEVRVPSSYRGQTCGLCGNFNGFAQDDLQGPDGRLLPTEASFGNSWKVPKGLGPGRPCSAGREVDPCRAAGYRARREANARCGILKTSPFSHCHAV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1085-1425 form the expressed segment for recombinant Mouse Kcp. The theoretical molecular weight of the Kcp protein is 44.7 kDa. Expression of this Kcp protein is conducted in e.coli. The Kcp gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Kcp protein during the following stages.
The mouse kielin/chordin-like protein (Kcp) is renowned for its regulatory effects on bone morphogenetic proteins (BMPs). Expressed across all stages of embryonic development, Kcp is particularly prominent in renal tubules within the kidney cortex, with no presence in the nephrogenic zone. Kcp suppresses the TGF-β1 signaling pathway. Kcp exhibits dual effects on different cytokines, enhancing BMPs while suppressing others, including TGF-β or activin. Studies have shown that Kcp can protect against unilateral ureteral obstruction (UUO)-induced renal fibrosis by regulating BMP7 expression. Kcp can also mitigate nonalcoholic fatty liver disease via modulating BMP4 and TGF-β1.
