Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial

Code CSB-EP720664MO
Abbreviation Recombinant Mouse Klra3 protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Klra3
Uniprot No.
Research Area
Others
Alternative Names
Klra3; Ly-49c; Ly49C; Killer cell lectin-like receptor 3; 5E6; Lymphocyte antigen 49c; Ly-49c; Nk2.1; T-cell surface glycoprotein Ly-49C
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
70-266aa
Target Protein Sequence
QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor on natural killer (NK) cells for class I MHC.
Gene References into Functions
  1. This docking mode was conserved with that previously observed for Ly49C.H-2K(b) Indeed, structure-guided mutation of Ly49C indicated that Ly49C.H2-Q10 and Ly49C.H-2K(b) possess similar energetic footprints focused around residues located within the Ly49C beta4-stand and L5 loop, which contact the underside of the peptide-binding platform floor. PMID: 27385590
  2. murine cytomegalovirus infection results in altered NK cell activation PMID: 24873973
  3. we have shown for the first time how the differential expression of the Ly49 inhibitory receptors during ontogeny can affect NK cell function PMID: 23960238
  4. This study showed that mPer2 is a critical clock component in modulating circadian rhythms in bone marrow, and it implies that Ly49C and Nkg2d may play an important role in mediating mPer2-controlled cytotoxic response. PMID: 20030538
  5. Three mutations have been introduced in Ly49C that correspond to Ly49A residues close to H-2Dd in the co-crystal, demonstrating that MHC class I binding by Ly49C is dependent on residues in the same area as that used by Ly49A for ligand contacts. PMID: 11777974
  6. signaling through the mouse NK inhibitory receptor Ly49C requires the presence of H-2Kb and this signaling is prevented when H-2Kb is ablated by pulsing with a peptide that can bind to it with high affinity PMID: 16148097
  7. adoptive infusion of alloreactive NK cells with silenced Ly49C gene results in suppression of graft-versus-host disease PMID: 19010415

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*