Recombinant Mouse Leucine-rich repeat LGI family member 3 (Lgi3)

In Stock
Code CSB-EP812997MO
Abbreviation Recombinant Mouse Lgi3 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Lgi3
Uniprot No.
Research Area
Neuroscience
Alternative Names
Lgi3Leucine-rich repeat LGI family member 3; Leubrin; Leucine-rich glioma-inactivated protein 3
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
31-548aa
Target Protein Sequence
KRPPKTPPCPPSCSCTRDTAFCVDSKSVPKNLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDGQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWFFAVADSSKAGATSLYRWHQNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRSQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGHRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Leucine-rich repeat LGI family member 3 (Lgi3) is produced in E. coli and consists of the full length of the mature protein, covering amino acids 31-548. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the product achieves greater than 85% purity—a level that appears adequate for most research applications.

Lgi3 belongs to the leucine-rich repeat LGI family, which seems to be involved in various cellular processes. This protein may play roles in signal transduction pathways and has drawn interest in studies examining cellular communication and neuronal function. Its apparent importance in modulating cell-to-cell interactions makes it a potentially valuable target for research in neurobiology and cell biology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The N-terminal 6xHis tag on this recombinant mouse Lgi3 protein allows for nickel-affinity based pull-down experiments to identify potential binding partners. Leucine-rich repeat domains—characteristic features of LGI family proteins—are known to mediate protein-protein interactions. This makes the construct well-suited for screening cellular lysates or purified protein libraries. The >85% purity level should be adequate for pull-down assays where His-tagged Lgi3 gets immobilized on nickel beads and used to capture interacting proteins for subsequent mass spectrometry analysis.

2. Antibody Development and Validation

This purified recombinant mouse Lgi3 protein can serve as an immunogen for generating polyclonal or monoclonal antibodies specific to mouse Lgi3. The full-length mature protein (31-548aa) provides comprehensive epitope coverage for antibody development. The purified protein also works as a positive control in Western blotting, ELISA, or immunoprecipitation experiments to validate antibody specificity and determine optimal working concentrations.

3. Biochemical Characterization and Stability Studies

Researchers can subject the recombinant protein to various biochemical analyses to characterize its biophysical properties. These might include thermal stability, pH tolerance, and aggregation behavior using techniques such as dynamic light scattering, differential scanning calorimetry, and size exclusion chromatography. Such studies would likely provide fundamental information about the protein's stability profile and optimal storage conditions for research applications.

4. Comparative Species Analysis in Cross-Reactivity Studies

This mouse Lgi3 protein can be used in comparative studies with human or other mammalian LGI3 orthologs to assess evolutionary conservation and species-specific differences. The purified protein serves as a reference standard for cross-reactivity testing of antibodies or binding assays developed for different species. This may contribute to translational research efforts between mouse models and human studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May participate in the regulation of neuronal exocytosis.
Gene References into Functions
  1. Taken together, these results support the critical involvement of LGI3 in the cytokine network by interplaying with multiple adipokines, cytokines and signaling proteins. PMID: 28534931
  2. findings show LGI3 and TNF-alpha upregulated each other in 3T3-L1 cells; study suggests LGI3 is a pro-inflammatory adipokine and forms a positive feedback loop with TNF-alpha; propose that LGI3 is a member of adipokine network that plays regulatory roles in obesity-associated adipose tissue inflammation PMID: 25648289
  3. results suggested that LGI3 may participate in adipose tissue homeostasis by negatively regulating adiponectin PMID: 23548727
  4. Data suggest that leucine-rich glioma inactivated 3 (LGI3) may be a candidate adipokine that is perturbed in obesity and suppresses adipogenesis through its receptor, ADAM23. PMID: 22405860
  5. LGI3 interacts with Flo1 in the brain, and LGI3/Flo1 mediates APP trafficking and exosome formation in neuronal cells: reveals the details of the intracellular transport system and even the secretion pathway in the brain. PMID: 20461023
  6. we propose that LGI3 is a neuritogenic factor whose signaling pathway involves Akt-mediated FAK activation. PMID: 20162351
  7. LGI3 gene widespread expression in the brain suggests that its transcripts might be involved in a common cellular process present in different neuronal types. PMID: 19833108
  8. The expression of mouse LGI3 (mLGI3) in adult and developing brain and analyzed the 5'-upstream transcriptional regulatory regions of mLGI3 gene. PMID: 16545924
  9. Data show that LGI3 localizes to the endocytic pathway and its accumulation is caused by endocytic perturbation. PMID: 18628660
  10. LGI3 may play a regulatory role in neuronal exocytosis via its interaction with syntaxin 1. PMID: 18760330

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Cell junction, synapse, synaptosome. Note=Found in the synaptosomal membrane fraction.
Tissue Specificity
Brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*