Recombinant Mouse Leucine-rich repeat LGI family member 3 (Lgi3)

In Stock
Code CSB-EP812997MO
Abbreviation Recombinant Mouse Lgi3 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Lgi3
Uniprot No.
Research Area
Neuroscience
Alternative Names
Lgi3Leucine-rich repeat LGI family member 3; Leubrin; Leucine-rich glioma-inactivated protein 3
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
31-548aa
Target Protein Sequence
KRPPKTPPCPPSCSCTRDTAFCVDSKSVPKNLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDGQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWFFAVADSSKAGATSLYRWHQNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRSQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGHRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Leucine-rich repeat LGI family member 3 (Lgi3) is produced in E. coli and consists of the full length of the mature protein, covering amino acids 31-548. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the product achieves greater than 85% purity—a level that appears adequate for most research applications.

Lgi3 belongs to the leucine-rich repeat LGI family, which seems to be involved in various cellular processes. This protein may play roles in signal transduction pathways and has drawn interest in studies examining cellular communication and neuronal function. Its apparent importance in modulating cell-to-cell interactions makes it a potentially valuable target for research in neurobiology and cell biology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Lgi3 is a leucine-rich repeat protein that likely requires proper folding for its function in protein-protein interactions and neuronal signaling. The E. coli expression system can produce soluble proteins, but it may not fully replicate the eukaryotic folding environment, potentially affecting disulfide bond formation or tertiary structure. The N-terminal 6xHis tag is small and unlikely to significantly interfere with folding. While the protein may be soluble and partially folded, the probability of correct folding with full functional activity is moderate but requires experimental validation. The high purity (>85%) supports reliable use in various assays.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

Protein-protein interactions depend on precise tertiary structure. While E. coli may produce folded protein, validation is needed to ensure native conformation. If correctly folded, the His-tag allows for effective pull-down assays to identify binding partners involved in Lgi3's signaling pathways. However, misfolding may lead to non-specific binding or false negatives. The leucine-rich repeat domains are interaction-prone, but results should be confirmed with complementary methods.

2. Antibody Development and Validation

This recombinant Lgi3 serves as an excellent immunogen for generating antibodies against mouse Lgi3. The full-length mature sequence ensures comprehensive epitope coverage. The His-tag facilitates purification and screening. Antibodies will be valuable for detecting Lgi3 in Western blot, ELISA, or immunohistochemistry.

3. Biochemical Characterization and Stability Studies

This is a priority application to assess the protein's physical properties. Techniques like size-exclusion chromatography, circular dichroism, and thermal shift assays can determine oligomeric state, secondary structure, and stability. These studies provide critical quality control data about the protein itself, not the native Lgi3.

4. Comparative Species Analysis in Cross-Reactivity Studies

This protein is well-suited for comparative studies with Lgi3 orthologs from other species, focusing on sequence-based comparisons or immunological cross-reactivity. However, functional comparisons (e.g., binding affinity) require validated folding and activity.

Final Recommendation & Action Plan

This recombinant Lgi3 is reliable for antibody development and biochemical characterization but requires folding validation before use in interaction studies. The immediate priority is Application 3 (Biochemical Characterization) to assess folding quality via biophysical methods. If folding is confirmed, proceed with Application 1 (Interaction Studies) with caution and validation. Applications 2 and 4 (Antibody Development and Comparative Analysis) can proceed immediately for non-functional uses. For functional studies, consider using eukaryotic expression systems if folding is inadequate. This approach ensures appropriate application based on protein quality.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May participate in the regulation of neuronal exocytosis.
Gene References into Functions
  1. Taken together, these results support the critical involvement of LGI3 in the cytokine network by interplaying with multiple adipokines, cytokines and signaling proteins. PMID: 28534931
  2. findings show LGI3 and TNF-alpha upregulated each other in 3T3-L1 cells; study suggests LGI3 is a pro-inflammatory adipokine and forms a positive feedback loop with TNF-alpha; propose that LGI3 is a member of adipokine network that plays regulatory roles in obesity-associated adipose tissue inflammation PMID: 25648289
  3. results suggested that LGI3 may participate in adipose tissue homeostasis by negatively regulating adiponectin PMID: 23548727
  4. Data suggest that leucine-rich glioma inactivated 3 (LGI3) may be a candidate adipokine that is perturbed in obesity and suppresses adipogenesis through its receptor, ADAM23. PMID: 22405860
  5. LGI3 interacts with Flo1 in the brain, and LGI3/Flo1 mediates APP trafficking and exosome formation in neuronal cells: reveals the details of the intracellular transport system and even the secretion pathway in the brain. PMID: 20461023
  6. we propose that LGI3 is a neuritogenic factor whose signaling pathway involves Akt-mediated FAK activation. PMID: 20162351
  7. LGI3 gene widespread expression in the brain suggests that its transcripts might be involved in a common cellular process present in different neuronal types. PMID: 19833108
  8. The expression of mouse LGI3 (mLGI3) in adult and developing brain and analyzed the 5'-upstream transcriptional regulatory regions of mLGI3 gene. PMID: 16545924
  9. Data show that LGI3 localizes to the endocytic pathway and its accumulation is caused by endocytic perturbation. PMID: 18628660
  10. LGI3 may play a regulatory role in neuronal exocytosis via its interaction with syntaxin 1. PMID: 18760330

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Cell junction, synapse, synaptosome. Note=Found in the synaptosomal membrane fraction.
Tissue Specificity
Brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*