Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Lgi3

Uniprot No.

Q8K406

Research Area

Neuroscience

Alternative Names

Lgi3Leucine-rich repeat LGI family member 3; Leubrin; Leucine-rich glioma-inactivated protein 3

Species

Mus musculus(Mouse)

Source

E.coli

Expression Region

31-548aa

Target Protein Sequence

KRPPKTPPCPPSCSCTRDTAFCVDSKSVPKNLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDGQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWFFAVADSSKAGATSLYRWHQNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRSQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGHRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

62.7 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

May participate in the regulation of neuronal exocytosis.

Gene References into Functions

Taken together, these results support the critical involvement of LGI3 in the cytokine network by interplaying with multiple adipokines, cytokines and signaling proteins. PMID: 28534931
findings show LGI3 and TNF-alpha upregulated each other in 3T3-L1 cells; study suggests LGI3 is a pro-inflammatory adipokine and forms a positive feedback loop with TNF-alpha; propose that LGI3 is a member of adipokine network that plays regulatory roles in obesity-associated adipose tissue inflammation PMID: 25648289
results suggested that LGI3 may participate in adipose tissue homeostasis by negatively regulating adiponectin PMID: 23548727
Data suggest that leucine-rich glioma inactivated 3 (LGI3) may be a candidate adipokine that is perturbed in obesity and suppresses adipogenesis through its receptor, ADAM23. PMID: 22405860
LGI3 interacts with Flo1 in the brain, and LGI3/Flo1 mediates APP trafficking and exosome formation in neuronal cells: reveals the details of the intracellular transport system and even the secretion pathway in the brain. PMID: 20461023
we propose that LGI3 is a neuritogenic factor whose signaling pathway involves Akt-mediated FAK activation. PMID: 20162351
LGI3 gene widespread expression in the brain suggests that its transcripts might be involved in a common cellular process present in different neuronal types. PMID: 19833108
The expression of mouse LGI3 (mLGI3) in adult and developing brain and analyzed the 5'-upstream transcriptional regulatory regions of mLGI3 gene. PMID: 16545924
Data show that LGI3 localizes to the endocytic pathway and its accumulation is caused by endocytic perturbation. PMID: 18628660
LGI3 may play a regulatory role in neuronal exocytosis via its interaction with syntaxin 1. PMID: 18760330

Hide All

Subcellular Location

Secreted. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Cell junction, synapse, synaptosome. Note=Found in the synaptosomal membrane fraction.

Tissue Specificity

Brain.

Database Links

KEGG: mmu:213469

STRING: 10090.ENSMUSP00000046705

UniGene: Mm.41708

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP812997MO
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Leucine-rich repeat LGI family member 3 (Lgi3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage