Recombinant Mouse Lithostathine-1 (Reg1)

In Stock
Code CSB-EP337329MO
Abbreviation Recombinant Mouse Reg1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Reg1
Uniprot No.
Research Area
Cell Biology
Alternative Names
Reg1; Lithostathine-1; Islet of Langerhans regenerating protein 1; REG 1; Pancreatic stone protein 1; PSP; Pancreatic thread protein 1; PTP; Regenerating protein 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
22-165aa
Target Protein Sequence
QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Elevate your cell biology studies with our Recombinant Mouse Reg1, also known as Islet of Langerhans regenerating protein 1. This E.coli-expressed protein is instrumental in numerous biological processes, particularly those related to cellular regeneration and repair.

Our Reg1 offers the full length of the mature protein (22-165aa), delivering a comprehensive view of its function and structure. This protein is expressed with a N-terminal 6xHis-SUMO tag, ensuring efficient purification and stability. With a purity of over 90% as determined by SDS-PAGE, our Recombinant Mouse Reg1 meets the stringent requirements of scientific investigation. You have the flexibility of choosing between a liquid form for immediate experimentation or lyophilized powder for prolonged storage, according to your research needs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Might act as an inhibitor of spontaneous calcium carbonate precipitation.
Gene References into Functions
  1. These results suggest that Reg1, which is released from acinar-like cell clusters touching Langerhans islets with thin interstitial surrounding to islet beta cell clusters, has a crucial role in beta cell regeneration in ncephalomyocarditis virus-induced diabetes. PMID: 29935186
  2. Reg I may play a role in the maintenance of mucosal barrier function by inducing tight junction proteins such as claudins 3 and 4. PMID: 27055226
  3. Members of the Reg gene family show distinct profiles of expression in the GI tract, and Reg I independently plays a role in protecting the GI mucosa against NSAID-induced injury. PMID: 25747353
  4. Regenerating 1 and 3b gene expression in the pancreas of type 2 diabetic Goto-Kakizaki (GK) rats PMID: 24587207
  5. This study implicates the Reg1 pathway in beta-cell regeneration and describes altered programming of gene expression in low protein offspring. PMID: 23986224
  6. Regenerating islet-derived 1alpha (Reg-1alpha) protein is new neuronal secreted factor that stimulates neurite outgrowth via exostosin Tumor-like 3 (EXTL3) receptor. PMID: 22158612
  7. Expression of Reg proteins in embryonic stem cells is modulated by Wnt/beta catenin signaling. PMID: 20050810
  8. Reg I(-/-) mice had a greater number of severe small intestinal lesions after indomethacin administration. Reg I may be useful as a therapeutic agent in NSAID-induced small intestinal injuries. PMID: 20508157
  9. transgenic overexpression of RegI (regenerating protein 1)accelerates the healing of experimental gastric ulcers. PMID: 20157293
  10. RegI and gastrin may synergistically regulate gastric mucosal proliferation during certain pathological settings like wound healing PMID: 19969026
  11. expression of the putative growth factor Reg1 is controlled through separate promoter elements by gastrin and Helicobacter. PMID: 17463184
  12. Demonstrate the presence of RegI in mouse testes. PMID: 18712671

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, moderately in gall bladder, and weakly in liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*