Recombinant Mouse Lymphocyte antigen 6K (Ly6k)

Code CSB-YP861475MO
Abbreviation Recombinant Mouse Ly6k protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Ly6k; Lymphocyte antigen 6K; Ly-6K
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
21-123aa
Target Protein Sequence
LTCHVCEAQNSYACSNPSQCPGEKKFCLLAVTRIFERFFYVSKQCTRRCPTPVVSPPSTNPPSEPKEFLIEKPMPFLFYKCCQWDSCNGEGPPTDQLLKEQPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
25-35 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida. May play a role in cell growth.
Gene References into Functions
  1. Study demonstrated that both TEX101 and Ly6k contribute mutually for their protein expression in the testicular germ cells, suggesting that the expression-balance of these two proteins is essential for fertile sperm formation. PMID: 27005865
  2. LY6K is a newly identified factor involved in sperm fertilizing ability PMID: 24501175
  3. This information is essential for the molecular classification of Ly6k, and may help uncover the detailed physiological role of Ly6k in gametogenesis, or cancer biology. PMID: 20920470
  4. Expression profiling confirmed that mLy-6K is expressed by plasma cells but not B cells or tissues not containing plasma cells. PMID: 18372042
  5. This study confirmed the biological interaction between TEX101 and Ly6k. PMID: 18503752

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Cell membrane; Lipid-anchor, GPI-anchor. Cytoplasmic vesicle, secretory vesicle, acrosome. Membrane raft.
Tissue Specificity
Strongly expressed in testes and weakly expressed in the epididymis, ovary, and uterus. Expressed in testicular germ cells (TGCs). Expressed in the testicular seminiferous tubules, in spermatocytes, spermatids, and testicular spermatozoa.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*