Recombinant Mouse NAD-dependent protein deacylase sirtuin-5, mitochondrial (Sirt5)

In Stock
Code CSB-EP814306MO
Abbreviation Recombinant Mouse Sirt5 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
others
Alternative Names
Regulatory protein SIR2 homolog 5 SIR2-like protein 5
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
37–310aa
Target Protein Sequence
SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 37–310 constitute the expression domain of recombinant Mouse Sirt5. This Sirt5 protein is expected to have a theoretical molecular weight of 37.6 kDa. This Sirt5 protein is produced using e.coli expression system. The Sirt5 gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Sirt5 protein during the following stages.

The mouse NAD-dependent protein deacylase sirtuin-5, mitochondrial (Sirt5) is an enzyme belonging to the sirtuin family. Sirtuins are involved in various cellular processes, including metabolism, aging, and stress response. Specifically localized in the mitochondria, Sirt5 plays a role in regulating protein post-translational modifications, including desuccinylation, demalonylation, and deglutarylation. By deacylating target proteins, Sirt5 influences metabolic pathways and contributes to the maintenance of mitochondrial function. Its deacylase activity has implications for cellular energy metabolism, oxidative stress response, and metabolic homeostasis. Understanding the functions of Sirt5 may offer insights into mitochondrial biology and potential therapeutic avenues for metabolic disorders and age-related conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting. Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species. Activates SHMT2 by mediating its desuccinylation. Modulates ketogenesis through the desuccinylation and activation of HMGCS2. Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as Uox.
Gene References into Functions
  1. Data indicate that sirtuin 5 (SIRT5) is an important mitochondrial enzyme for protection against metabolic and ischemic stress following protein kinase C epsilon (PKCepsilon) activation in the brain. PMID: 27435822
  2. findings reveal a key role for SIRT5 in maintaining cardiac oxidative metabolism under pressure overload to ensure survival PMID: 28972174
  3. Deletion of Sirt5 in starved mouse embryonic fibroblasts increased levels of mitochondrial dynamics leading to mitochondrial accumulation of the pro-fission Drp1 and to mitochondrial fragmentation. PMID: 28340937
  4. Our study uncovers a SIRT5-dependent mechanism that regulates cellular NADPH homeostasis and redox potential by promoting IDH2 desuccinylation and G6PD deglutarylation. PMID: 27113762
  5. Data (including data from studies using knockout mice) suggest that SIRT5 is targeted to protein complexes on the inner mitochondrial membrane via affinity for cardiolipin to promote respiratory chain function, particularly Complex I and Complex II; SIRT5 expression is observed in inner mitochondrial membrane of periportal hepatocytes. PMID: 28458255
  6. Data show that peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1alpha) overexpression significantly increased the expression of sirtuin 3 (SIRT3) and sirtuin 5 (SIRT5). PMID: 27052737
  7. In the cochlea, the expression of SIRT1, 3, and 5 (both mRNA and protein) was decreased in the old mice PMID: 26472659
  8. These findings establish that regulating heart metabolism and function is a major physiological function of lysine succinylation and SIRT5. PMID: 27051063
  9. SIRT5 has a role in cellular metabolism with a multiple enzymatic activities PMID: 26208827
  10. SIRT3 and SIRT5 regulate the enzyme activity and cardiolipin binding of very long-chain acyl-CoA dehydrogenase PMID: 25811481
  11. Pathway analysis identified glycolysis as the top SIRT5-regulated pathway. Importantly, glycolytic flux was diminished in primary hepatocytes from Sirt5(-/-) compared to WT mice. PMID: 26073543
  12. Data indicated that SIRT5 ameliorates MPTP-induced nigrostriatal dopaminergic degeneration via preserving mitochondrial antioxidant capacity. PMID: 25541039
  13. Lysine glutarylation is a protein posttranslational modification regulated by SIRT5. PMID: 24703693
  14. Loss of SIRT5 leads to accumulation of medium- and long-chain acylcarnitines and decreased beta-hydroxybutyrate production in vivo. PMID: 24315375
  15. Sirt5 is likely to be dispensable for the metabolic homeostasis under the basal conditions. PMID: 24076663
  16. We have isolated and characterized the murine sirt5 genomic sequence, which spans a region of 24,449 bp and which has one single genomic locus. PMID: 23673559
  17. SIRT5 represses biochemical activity of, and cellular respiration through, two protein complexes identified as pyruvate dehydrogenase complex and succinate dehydrogenase. PMID: 23806337
  18. The results suggest that SIRT5 activates UOX through deacetylation in mouse liver mitochondria. PMID: 23085393
  19. These data indicate SIRT5 also has a role in the metabolic adaptation to fasting, high protein diet and calorie restriction. PMID: 20157539
  20. Because ammonia generated during fasting is toxic, SIRT5 protein might play a protective role by converting ammonia to non-toxic urea through deacetylation and activation of CPS1. PMID: 20097174
  21. results suggest that the SIRT3, SIRT4, and SIRT5 proteins exert distinct functions in mitochondria. PMID: 18054327
  22. SIRT5 plays a pivotal role in ammonia detoxification and disposal by activating carbamoyl phosphate synthetase 1 PMID: 19410549

Show More

Hide All

Subcellular Location
Mitochondrion. Cytoplasm, cytosol. Nucleus. Note=Mainly mitochondrial. Also present extramitochondrially, with a fraction present in the cytosol and very small amounts also detected in the nucleus.
Protein Families
Sirtuin family, Class III subfamily
Tissue Specificity
Detected in brain, liver, heart, kidney, lung, thymus, spleen, skeletal muscle, intestine, pancreas and testis (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*