Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Regulatory protein SIR2 homolog 5
SIR2-like protein 5
Species
Mus musculus (Mouse)
Expression Region
37–310aa
Target Protein Sequence
SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 37–310 constitute the expression domain of recombinant Mouse Sirt5. This Sirt5 protein is expected to have a theoretical molecular weight of 37.6 kDa. This Sirt5 protein is produced using e.coli expression system. The Sirt5 gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Sirt5 protein during the following stages.
The mouse NAD-dependent protein deacylase sirtuin-5, mitochondrial (Sirt5) is an enzyme belonging to the sirtuin family. Sirtuins are involved in various cellular processes, including metabolism, aging, and stress response. Specifically localized in the mitochondria, Sirt5 plays a role in regulating protein post-translational modifications, including desuccinylation, demalonylation, and deglutarylation. By deacylating target proteins, Sirt5 influences metabolic pathways and contributes to the maintenance of mitochondrial function. Its deacylase activity has implications for cellular energy metabolism, oxidative stress response, and metabolic homeostasis. Understanding the functions of Sirt5 may offer insights into mitochondrial biology and potential therapeutic avenues for metabolic disorders and age-related conditions.