Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Nenf

Uniprot No.

Q9CQ45

Research Area

Neuroscience

Alternative Names

Neuron-derived neurotrophic factor;Secreted protein of unknown function

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

31-171aa

Target Protein Sequence

GQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDTTGLTAKELEALDDVFSKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.5 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Acts as a neurotrophic factor in postnatal mature neurons, enhancing neuronal survival. Promotes cell proliferation and neurogenesis in undifferentiated neural pro-genitor cells at the embryonic stage and inhibits differentiation of astrocytes. Its neurotrophic activity is exerted via MAPK1/ERK2, MAPK3/ERK1 and AKT1/AKT pathways. Neurotrophic activity is enhanced by binding to heme. Acts also as an anorexigenic neurotrophic factor that contributes to energy balance.

Gene References into Functions

neudesin, which may be a negative regulator of sympathetic activity, could represent a novel regulator of the development of obesity and obesity-related metabolic dysfunctions. PMID: 25955136
Neuron-derived neurotrophic factor (NENF) is an important central modulator of food intake. PMID: 23576617
identification of neudesin, a novel mouse secreted protein showing neurotrophic activity in primary cultured mouse neurons PMID: 15605373
The present findings have revealed new potential roles of neudesin in neural cell proliferation and neuronal differentiation. PMID: 16547973
Neudesin is the first extracellular heme-binding protein that shows signal transducing activity by itself. The present findings may shed new light on the function of extracellular heme-binding proteins PMID: 18056703
These findings suggest that neudesin plays a critical role in the early stage of adipocyte differentiation in which C/EBPbeta induces PPARgamma and C/EBPalpha expressions, by controlling the MAPK pathway. PMID: 19351598

Hide All

Subcellular Location

Secreted, extracellular space. Mitochondrion. Endoplasmic reticulum.

Protein Families

Cytochrome b5 family, MAPR subfamily

Tissue Specificity

In the embryo, expressed most abundantly in brain and spinal cord. Widely expressed in adult tissues including brain, heart, lung and kidney. In brain, expressed in neurons but not in glial cells. In the hypothalamus is expressed primarily in the paravent

Database Links

KEGG: mmu:66208

STRING: 10090.ENSMUSP00000046311

UniGene: Mm.46444

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP880396MO
Abbreviation	Recombinant Mouse Nenf protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Neudesin (Nenf)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage