Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Npm3

Uniprot No.

Q9CPP0

Research Area

Epigenetics and Nuclear Signaling

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

2-175aa

Target Protein Sequence

AAGAAAALAFLNQESRARAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDTEHVLALNMLCLTEGATDECNVVEVVARDHDNQEIAVPVANLRLSCQPMLSVDDFQLQPPVTFRLKSGSGPVRITGRHQIVCINNDLSEEESDDESEEDEIKLCGILPAKKHRGRP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.112.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Plays a role in the regulation of diverse cellular processes such as ribosome biogenesis, chromatin remodeling or protein chaperoning. Modulates the histone chaperone function and the RNA-binding activity of nucleolar phosphoprotein B23/NPM. Efficiently mediates chromatin remodeling when included in a pentamer containing NPM3 and NPM.

Gene References into Functions

Overexpression of a mutant of NPM3 that did not interact with B23 did not alter pre-rRNA synthesis and processing, suggesting that the interaction of NPM3 with B23 plays a role in the ribosome biogenesis PMID: 15596447
A chromatin remodeling protein responsible for the unique chromatin structure and replicative capacity of embryonic stem cells. PMID: 18462200

Subcellular Location

Nucleus. Nucleus, nucleolus.

Protein Families

Nucleoplasmin family

Tissue Specificity

Predominantly expressed in testis.

Database Links

KEGG: mmu:18150

UniGene: Mm.1406

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP871862MO
Abbreviation	Recombinant Mouse Npm3 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Nucleoplasmin-3 (Npm3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage