Recombinant Mouse Oncomodulin (Ocm)

In Stock
Code CSB-YP016264MO
Abbreviation Recombinant Mouse Ocm protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Ocm
Uniprot No.
Research Area
Neuroscience
Alternative Names
Ocm; Oncomodulin; OM; Parvalbumin beta
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
2-109aa
Target Protein Sequence
SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In the production of recombinant Mouse Ocm protein, the gene for Ocm (Yeast) was cloned into a vector and expressed as Ocm protein in Yeast. The plasmids with the copy of Ocm, or the expression vector, were often used to enhance gene expression. Every step of production was undergone with a strict QC system. N-terminal 6xHis tag was used in the process. The purity is 90% determined by SDS-PAGE.

Oncomodulin (OCM) is a small EF-hand Ca2+-binding protein (CaBP) of approximately 12 kDa belonging to the parvalbumin family. Initially, OCM was considered oncogenic due to lack of evidence of any expression in normal post-embryonic tissue. However, decades after its initial discovery, OCM was identified as a major protein in sensory cells of the guinea pig cochlea. There are only a limited number of studies on the function of OCM largely due to its very restricted temporal and spatial expression patterns. Also, only a few OCM studies have addressed: intracellular concentration, affinity for metal ions, mobility, and Ca2+-sensing capacity. Existing findings show that OCM is evolutionarily distinguished from the majority of lower vertebrate β-parvalbumins. OCM may have an ambiguous function that depends upon the cell type in which it is expressed, and this ambiguity further distinguishes it from other EF-hand CaBPs. In sensory cells, recent studies suggest that OCM plays an essential role in maintaining auditory function, most likely affecting OHC motility mechanisms. In immune cells, OCM may be secreted in response to inflammatory signals and facilitates axon regeneration.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Gene References into Functions
  1. These data suggest that Ocm may have distinct functional roles in cochlear and vestibular hair cells. PMID: 20653034
  2. absence of parvalbumin has no major effect on the GABA-synthesizing system in diencephalon presynaptic terminals; however, a likely homeostatic mechanism is induced resulting in the upregulation of oncomodulin in selected axons and neuronal perikarya PMID: 19874871
Protein Families
Parvalbumin family
Tissue Specificity
Found in tumor tissues and not detected in normal tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*