Recombinant Mouse Oncomodulin(Ocm)

Code CSB-YP016264MO
Product Type Recombinant Protein
Size US$2959
Uniprot No. P51879
Relevance Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Parvalbumin beta
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Research Area Neuroscience
Source Yeast
Gene Names Ocm
Protein Names Recommended name: Oncomodulin Short name= OM Alternative name(s): Parvalbumin beta
Expression Region 2-109aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 14.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Protein Families Parvalbumin family
Tissue Specificity Found in tumor tissues and not detected in normal tissues.
Database Links

KEGG: mmu:18261

STRING: 10090.ENSMUSP00000031622

UniGene: Mm.270533

Related Products

Ocm Antibodies

Ocm Antibodies for Mouse

Ocm Antibodies for Mus musculus (Mouse)

Ocm Proteins

Ocm Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.