Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Ocm; Oncomodulin; OM; Parvalbumin beta
Species
Mus musculus (Mouse)
Expression Region
2-109aa
Target Protein Sequence
SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
In the production of recombinant Mouse Ocm protein, the gene for Ocm (Yeast) was cloned into a vector and expressed as Ocm protein in Yeast. The plasmids with the copy of Ocm, or the expression vector, were often used to enhance gene expression. Every step of production was undergone with a strict QC system. N-terminal 6xHis tag was used in the process. The purity is 90% determined by SDS-PAGE.
Oncomodulin (OCM) is a small EF-hand Ca2+-binding protein (CaBP) of approximately 12 kDa belonging to the parvalbumin family. Initially, OCM was considered oncogenic due to lack of evidence of any expression in normal post-embryonic tissue. However, decades after its initial discovery, OCM was identified as a major protein in sensory cells of the guinea pig cochlea. There are only a limited number of studies on the function of OCM largely due to its very restricted temporal and spatial expression patterns. Also, only a few OCM studies have addressed: intracellular concentration, affinity for metal ions, mobility, and Ca2+-sensing capacity. Existing findings show that OCM is evolutionarily distinguished from the majority of lower vertebrate β-parvalbumins. OCM may have an ambiguous function that depends upon the cell type in which it is expressed, and this ambiguity further distinguishes it from other EF-hand CaBPs. In sensory cells, recent studies suggest that OCM plays an essential role in maintaining auditory function, most likely affecting OHC motility mechanisms. In immune cells, OCM may be secreted in response to inflammatory signals and facilitates axon regeneration.