Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Ocm; Oncomodulin; OM; Parvalbumin beta
Species
Mus musculus (Mouse)
Expression Region
2-109aa
Target Protein Sequence
SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Recombinant Mouse Ocm is a synthetic version of the mouse Oncomodulin protein, also known as OM or Parvalbumin beta. This vital protein, pivotal in the field of Neuroscience, is reproduced faithfully in our state-of-the-art facilities to ensure accurate experimental outcomes.
The Recombinant Mouse Ocm features the full length of the mature protein, spanning from the 2nd to the 109th amino acid, closely mimicking the natural protein's structure and function. This product is expressed in E. coli and possesses an N-terminal 6xHis-SUMO tag, assisting in effortless purification and detection procedures. The purity level of this protein is more than 90%, as determined by SDS-PAGE, making it a reliable choice for your scientific research. The protein is offered in either a liquid form or a lyophilized powder to suit your specific requirements.
