Recombinant Mouse Oncomodulin (Ocm)

In Stock
Code CSB-EP016264MO
Abbreviation Recombinant Mouse Ocm protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Ocm
Uniprot No.
Research Area
Neuroscience
Alternative Names
Ocm; Oncomodulin; OM; Parvalbumin beta
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
2-109aa
Target Protein Sequence
SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Mouse Ocm is a synthetic version of the mouse Oncomodulin protein, also known as OM or Parvalbumin beta. This vital protein, pivotal in the field of Neuroscience, is reproduced faithfully in our state-of-the-art facilities to ensure accurate experimental outcomes.

The Recombinant Mouse Ocm features the full length of the mature protein, spanning from the 2nd to the 109th amino acid, closely mimicking the natural protein's structure and function. This product is expressed in E. coli and possesses an N-terminal 6xHis-SUMO tag, assisting in effortless purification and detection procedures. The purity level of this protein is more than 90%, as determined by SDS-PAGE, making it a reliable choice for your scientific research. The protein is offered in either a liquid form or a lyophilized powder to suit your specific requirements.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Gene References into Functions
  1. These data suggest that Ocm may have distinct functional roles in cochlear and vestibular hair cells. PMID: 20653034
  2. absence of parvalbumin has no major effect on the GABA-synthesizing system in diencephalon presynaptic terminals; however, a likely homeostatic mechanism is induced resulting in the upregulation of oncomodulin in selected axons and neuronal perikarya PMID: 19874871
Protein Families
Parvalbumin family
Tissue Specificity
Found in tumor tissues and not detected in normal tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*