Recombinant Mouse Oxytocin-neurophysin 1 (Oxt), partial

Code CSB-EP017315MO
Abbreviation Recombinant Mouse Oxt protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Oxt; Oxytocin-neurophysin 1; OT-NPI) [Cleaved into: Oxytocin; Ocytocin); Neurophysin 1]
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
32-125aa
Target Protein Sequence
AVLDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.1 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR).
Gene References into Functions
  1. The abnormal social behaviors of Dio3-/- mice were associated with sexually dimorphic alterations in the physiology of oxytocin (OXT) and arginine vasopressin (AVP), 2 neuropeptides with important roles in determining social interactions. PMID: 28715127
  2. Data indicate that oxytocin participates in the spine remodeling, synaptic refinement, and social stimuli-dependent plasticity in the posterodorsal medial amygdala of male mice. PMID: 28889007
  3. Activation of the oxytocin receptor in brain regions facilitates social defeat posture. PMID: 29186377
  4. the absence of OT leads to significant changes in the expression of the studied genes (OTR, ERalpha, ERbeta, V1aR), and these changes may contribute to the decreased sexual behavior observed in OT gene knockout females. PMID: 27558735
  5. These results reveal that Oxt protects pancreatic beta cells against death caused by metabolic stress, and Oxt signaling may be a potential therapeutic target. PMID: 27143105
  6. CA3 pyramidal cells in the adult mouse hippocampus express OXT receptors and receive inputs from hypothalamic OXT neurons. PMID: 28912554
  7. These results identify G9a-induced histone methylation at the OXT and AVP promoters in the Basolateral Amygdala as a mechanism for mediating stress-induced lasting behavioral depression and its reversal by exercise. PMID: 25863961
  8. Data indicate that oxytocin is an important synaptic modulator in the posterodorsal medial amygdala, a finding that is likely involved with the display of the female sexual behavior. PMID: 26163772
  9. OXT was up-regulated in both hypothalamic magnocellular neurosecretory cells and parvocellular cells by chronic inflammation, and also that OXT in the PVN-spinal pathway may be involved in sensory modulation PMID: 25943916
  10. role for a neuronal population in the control of maternal care and oxytocin secretion; and evidence for a causal relationship between sexual dimorphism in the adult brain and sex differences in parental behaviour PMID: 26375004
  11. Oxtr signaling is crucial for entrainment of odor to social cues but is dispensable for entrainment to nonsocial cues. Oxt conveys saliency of social stimuli to sensory representations in the piriform cortex during odor-driven social learning. PMID: 26139372
  12. Oxytocin is is required for proper muscle tissue regeneration and homeostasis, and that plasma levels of oxytocin decline with age. Genetic lack of oxytocin does not cause a developmental defect in muscle but instead leads to premature sarcopenia. PMID: 24915299
  13. results describe fundamental synaptic mechanisms by which oxytocin increases the salience of acoustic social stimuli; furthermore, oxytocin-induced plasticity provides a biological basis for lateralization of auditory cortical processing PMID: 25874674
  14. Results show that OT inhibits appetite for carbohydrates; sucrose consumption considerably enhances OT gene expression and is particularly sensitive to OT receptor blockade PMID: 24893201
  15. Data suggest that oxytocin plays a crucial role in the sexual behavior display, number of released oocytes and density of dendritic spines in the MePD of female mice without affecting AVP plasma concentration PMID: 23906766
  16. lactic acid microbes accelerate wound healing via the neuropeptide hormone oxytocin PMID: 24205344
  17. CD38 in the nucleus accumbens and oxytocin are critical in paternal behavior. PMID: 24059452
  18. A new form of plasticity is identified in neonatal mice, when early sensory experience cross-modally regulates development of all sensory cortices via oxytocin signaling. PMID: 24464043
  19. the rewarding properties of social interaction in mice require the coordinated activity of oxytocin and 5-HT in the nucleus accumbens--with implications for understanding the pathogenesis of social dysfunction in neuropsychiatric disorders like autism PMID: 24025838
  20. data suggest that OT modulates social investigation behavior and the aggressiveness of male mice. T PMID: 23376700
  21. Oxytocin pathways may not be essential for regulating voluntary sodium ingestion. PMID: 22784207
  22. medial amygdala likely modulates hostile aggressive behavior associated with immediate early gene expression in OXT and vasopressin neurons PMID: 23403283
  23. these results support the hypothesis that the expression of the mouse oxytocin receptor gene is epigenetically regulated by DNA methylation of its promoter. PMID: 23441222
  24. We conclude that Maged1 is required for oxytocin processing or stability. A decrease in mature OT levels in Maged1 mutants affects social interactions and possibly other behavioral processes PMID: 22865874
  25. OT release in bone marrow by a rising estrogen concentration may facilitate rapid skeletal recovery during the latter phases of lactation. PMID: 22761429
  26. We consider hypotheses of the roles played by central and systemic OT release as well as their control and modulation in the female in mating and pregnancy--REVIEW PMID: 22107910
  27. we describe data detailing the molecular mechanism of CD38-dependent OXT secretion in CD38 knockout mice--REVIEW PMID: 22227279
  28. results support the idea that variation in ovarian hormones could be related to individual differences in social recognition, at least partly through modulation of the OT and/or AVP systems, particularly in the DS, LA and MPOA. PMID: 22079582
  29. The data suggested that vasopressin or oxytocin exert a minimal effect on most GABA neurons in the lateral hypothalamus but exert a robust excitatory effect on presumptive GABA cells that contain melanin-concentrating hormone. PMID: 22262306
  30. there is a local feed-forward loop in bone marrow through which the OT so produced from osteoblasts in response to estrogen acts upon its receptor to exert a potent anabolic action. PMID: 21741363
  31. Oxytocin plays a pivotal role in mediating the adaptation mechanism following chronic homotypic stress in mice. PMID: 21439349
  32. Fto, a proposed transcription co-factor, influences expression of the gene encoding a satiety mediator, oxytocin. PMID: 21514276
  33. Recently a new tool has been created that has furthered our understanding of oxytocin's role in behavior: transgenic mice that lack either the ability to synthesize oxytocin or the oxytocin receptor itself--REVIEW PMID: 20732312
  34. global reduction in FGF8 signaling leads to an overall reduction of mature OT and oxyphysin prohormone levels that may have resulted from defects in multiple stages of the hormone-synthesis pathway PMID: 21046478
  35. central oxytocin plays a pivotal role in mediating the adaptation mechanism following repeated restraint stress in mice PMID: 20969650
  36. Oxytocin acts as a carbohydrate-specific inhibitor of feeding. PMID: 20685878
  37. OXT elicits Ca2+ signals via OXTR in murine taste buds PMID: 20700536
  38. Data show that EBs expressed Oct-4, OTR, OT, and DAZL. PMID: 19695304
  39. The upregulation of central oxytocin expression is involved in mediating the adaptation mechanism following chronic repeated stress in mice. PMID: 19889866
  40. oxytocin mediates stress-induced analgesia PMID: 11956346
  41. The OT/OTR system plays an important role in cardiogenesis by promoting cardiomyocyte differentiation. PMID: 12093924
  42. Results suggest that estrogen receptor-beta activation may play a critical role in estrogenic regulation of oxytocin and arginine vasopressin gene expression in the paraventricular nucleus. PMID: 12531518
  43. OT is 1)involved in tonic blood pressure maintenance; 2)extends the functional range of arterial baroreceptor reflex; 3)reduces the sympathetic reserve PMID: 12531722
  44. required for mammalian social recognition, through which an individual learns to recognize other individuals PMID: 12730370
  45. that OT pathways play a role in modulating anxiety in female mice of the C57BL/6 background, and the effect is mediated by the OT receptor. PMID: 12746288
  46. oestrogen-dependent regulation of oxytocin and vasopressin synthesis in the paraventricular hypothalamic nucleus is mediated by ERbeta. PMID: 12834440
  47. Blood oxytocin concentrations on d 9 postpartum were also lower in Usf2-/- mice than Usf2+/+ mice PMID: 12907752
  48. Regulatory element in the intergenic region of the oxytocin gene controls hypothalamus-specific expression. PMID: 12944509
  49. Oxytocin plays a role in the regulation of blood pressure and salt appetite. PMID: 12953013
  50. OT signaling pathways are unnecessary for the anorexigenic effects of systemically administered CCK and d-fenfluramine in C57BL/6 mice. PMID: 14557235

Show More

Hide All

Protein Families
Vasopressin/oxytocin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*