Recombinant Mouse Parvalbumin alpha (Pvalb)

In Stock Promotion
Code CSB-EP019092MO
Abbreviation Recombinant Mouse Pvalb protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
2-110aa
Target Protein Sequence
SMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLVAES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Parvalbumin alpha (Pvalb) gets expressed in E. coli and covers the full mature protein length, spanning amino acids 2-110. This product comes with dual tagging - an N-terminal 10xHis-tag paired with a C-terminal Myc-tag, which makes purification and detection more straightforward. The protein reaches greater than 90% purity, as confirmed by SDS-PAGE. This level of purity appears to make it well-suited for demanding research applications.

Parvalbumin alpha is a calcium-binding protein that's typically involved in regulating muscle relaxation and neuronal signaling. It seems to play an important role in calcium homeostasis and acts as a key component across various physiological pathways. Researchers often rely on its presence as a marker when investigating muscle and neuronal function, which likely makes it a useful tool in both basic and applied research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant mouse Pvalb is expressed in E. coli, a prokaryotic system that is generally suitable for producing small, stable proteins like parvalbumin. Parvalbumin is a calcium-binding protein with EF-hand motifs that require precise folding and metal ion coordination for functionality. While E. coli can often properly fold small soluble proteins, the presence of dual tags (N-terminal 10xHis and C-terminal Myc) may interfere with the native structure, particularly at the termini. The protein is full-length mature (2-110aa) with >90% purity, which is favorable. However, since activity is unverified and parvalbumin requires specific calcium-binding capability, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its calcium-binding properties.

1. Antibody Development and Validation

This application is appropriate. The recombinant Pvalb can serve as an effective immunogen for generating antibodies that recognize linear epitopes. The high purity and full-length sequence support antibody production. However, the dual tags may generate antibodies against non-native epitopes. If the protein is misfolded, antibodies may not recognize conformational epitopes of native parvalbumin. Validation against endogenous parvalbumin is recommended.

2. Protein-Protein Interaction Studies

The dual tags enable technical feasibility for pull-down assays, but this application requires caution. Parvalbumin's interactions are calcium-dependent and conformation-sensitive. If the recombinant mouse Pvalb is misfolded or has impaired calcium-binding, identified interactions may not be physiological. This application should only be pursued after confirming proper folding and calcium-binding functionality.

3. Biochemical Characterization and Calcium-Binding Studies

This application is valuable but highly dependent on correct folding. Basic biochemical studies are feasible, but calcium-binding assays require proper EF-hand motif formation. If the protein is misfolded, calcium affinity measurements will be invalid. These studies should include validation of proper folding through circular dichroism (to confirm expected α-helical content) before interpreting calcium-binding data.

4. ELISA Development and Quantitative Assays

This application is feasible but with limitations. The tags facilitate assay development, but if Pvalb is misfolded, quantitative measurements may not correlate with native protein levels. The assay may work for detection, but requires validation against properly folded parvalbumin to ensure accurate quantification.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, recommend first performing biophysical and functional characterization. This should include circular dichroism spectroscopy to verify the expected α-helical content characteristic of parvalbumin's EF-hand motifs, and calcium-binding assays using isothermal titration calorimetry or fluorescence-based methods to confirm functionality. Antibody development can proceed as the safest application. Protein interaction studies and quantitative assays should await proper folding validation. For reliable calcium-binding studies, ensure the protein is properly refolded if necessary, and include calcium-free and calcium-saturated controls in experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
Gene References into Functions
  1. Data indicate that fast-spiking interneurons which typically express parvalbumin (PV) show greater firing coherence with CA1 network oscillations. PMID: 28382952
  2. Martinotti cells in layers II/III of the mouse primary somatosensory cortex are inhibited by both parvalbumin (PV)- and vasoactive intestinal polypeptide (VIP)-expressing cells. PMID: 27897179
  3. Synapses from parvalbumin-expressing interneurons onto hippocampal pyramidal neurons are regulated by neuronal firing, signaling through L-type calcium channels. PMID: 29295931
  4. This study investigated the distribution of Ca2+-binding proteins (CaBPs), such as calbindin D28k, parvalbumin, and calretinin, in the Superior Olivary Complex of the circling mouse on postnatal day 16. PMID: 29130968
  5. Axotomy Leads to Reduced Calcium Increase and Upregulated Parvalbumin Followed by Decreased Neighboring Microglial Activation. PMID: 28017131
  6. reduction of PV(+) neurons was in all cases, i.e., in PV+/-, Shank1-/- and Shank3B-/- mice, was due to a reduction in Pvalb mRNA and PV protein PMID: 26819149
  7. The calcium-binding protein parvalbumin (PV) is a crucial marker in defining the most predominant interneuron subtype within the cerebral cortex. PMID: 26882036
  8. dysfunction of parvalbumin positive interneurons signaling in the prefrontal cortex (PFC) specifically produces deficits in the cognitive domain, but does not give rise to PFC-dependent correlates of negative or positive symptoms. PMID: 26608841
  9. Thus PV+ GP neurons are synaptically positioned to directly coordinate activity between BG input nuclei, the striatum and STN, and thalamic-output from the SNr. PMID: 26905595
  10. These findings confirm that fate determination of cortical interneurons subgroups is crucially influenced by Shh signaling, and provide a system for the further study of interneuron fate and function. PMID: 25804737
  11. Parvalbumin and Npas1 neurons have different topologies within the basal ganglia. PMID: 26311767
  12. Nearly all parvalbumin interneurons express Lynx1 did not detect Lypd6 in this population. Conversely, in somatostatin interneurons Lypd6 was found in a subset localized to deep cortical layers but no somatostatin neurons show detectable levels of Lynx1. PMID: 25359633
  13. Our data indicate that the injury-triggered up-regulation of PV-expression is mediated by inflammatory cytokines, and promotes the motility and adhesion of ependymal cells. PMID: 25421913
  14. There was a significant correlation between Y-maze performance and PV expression in the dorsal hippocampus in WT mice, but no such correlation in BDNF+/- mice. PMID: 25603414
  15. EF-hand Ca(2+) buffers regulate presynaptic IHC function for metabolically efficient sound coding. PMID: 25691754
  16. Fgfr1 inactivation in the mouse telencephalon results in impaired maturation of interneurons expressing parvalbumin. PMID: 25116473
  17. This study demonistrated that Early- and late-born parvalbumin basket cell subpopulations exhibiting distinct regulation and roles in learning. PMID: 25695271
  18. Impaired excitability of somatostatin- and parvalbumin-expressing cortical interneurons in a mouse model of Dravet syndrome. PMID: 25024183
  19. This study demonistrated that the developmental trajectory of parvalbumin- and calretinin-positive interneurons along the dorso-ventral and rostro-caudal axes of the ventral hippocampus in juvenile, adolescent, and adult rats. PMID: 23893875
  20. Suppression of excitatory parvalbumin-positive fast spiking interneurons in the prelimbic area may enhance reward-related behavioral flexibility. PMID: 24599468
  21. Parvalbumin tunes spike-timing and efferent short-term plasticity in striatal fast spiking interneurons. PMID: 23551945
  22. The results of this study suggested a niche mechanism involving parvalbumin interneurons that couples local circuit activity to the diametric regulation of two critical early phases of adult hippocampal neurogenesis. PMID: 24212671
  23. This study demonistrated that Parvalbumin-expressing inhibitory interneurons in auditory cortex are well-tuned for frequency in mice. PMID: 23966693
  24. These results suggest the fact that the maintenance of parvalbumin expression is mediated to the neuroprotective function of nicotinamide against ischemic brain injury. PMID: 23047329
  25. We failed to provide proof-of-concept evidence that lower PV and GAT1 expression in schizophrenia are a consequence of lower GAD67 expression PMID: 23103418
  26. The rapid spiking inhibitory interneurons that co-express PV are involved in shaping neural responses to fast spectrotemporal modulations. We examined cortical PV expression in the C57bl/6 mouse, a strain commonly studied as a presbycusis model. PMID: 23010334
  27. In a circling mouse model of deafness, there is a decrese in expression of parvalbumin in the hippocampus. PMID: 22226504
  28. Increase in NF-kappaB activation coincides with increased reactive oxygen species production and decreased parvalbumin expression in parvalbumin-interneurons in vitro. PMID: 21378588
  29. The results of this study indicated that PV cells are ideally suited to modulate cortical gain and establish a causal relationship between a select neuron type and specific computations performed by the cortex during sensory PMID: 22243754
  30. phenotype of mice with GABA(A) receptor gamma2 subunits from parvalbumin neurons PMID: 21912668
  31. Our work indicates that parvalbumin and the cannabinoid-1 (CB1) receptor might be far more intricately related than previously thought. PMID: 21445945
  32. The relative mean density of calbindin and parvalbumin immunoreactivity in the Purkinje cell layer is significantly decreased in the homozygous cir/cir genotype, compared with the wild-type. PMID: 20691752
  33. Data show that parvalbumin-positive interneurons are dispensable for spatial reference, but are essential for spatial working memory. PMID: 21278730
  34. These data provide more direct evidence of the protective role of parvalbumin against the degeneration mediated by a calcium increase in the acute injury of motor neurons. PMID: 20394052
  35. Data conclude that GPx4 is a selenoenzyme modulating interneuron function and parvalbumin expression. PMID: 19890015
  36. The expression of PV and its colocalization with neuronal nitric oxide synthase have been determined in different populations of hippocampal GABAergic neurons. PMID: 12115690
  37. Parvalbumin deficiency, due to an increased short-term facilitation of GABA release, enhances inhibition by high-frequency burst-firing PV-expressing interneurons and may affect the higher cognitive functions associated with gamma oscillations. PMID: 12626620
  38. The slight aggravation of muscle dystrophy observed in mdx mice deprived of parvalbumin cannot explain the severity of the affection observed in xmd dogs and Duchenne dystrophy patients where parvalbumin is constitutively not expressed. PMID: 12798793
  39. Distinct kinetics of parvalbumin and calbindin D28k underlie biphasic kinetics of synaptically evoked Ca2+ transients in dendritic shafts of Purkinje cells. PMID: 12813159
  40. This study conclude that alterations in the Ca(2+) homeostasis present in mice ectopically expressing neuronal PV are more deleterious under excitotoxic stress PMID: 14980812
  41. Parvalbumin arises as a major contributor to presynaptic Ca(i) signals and synaptic integration in the cerebellar cortex. PMID: 15634771
  42. Retinal illumination had opposite effects on levels of parvalbumin and oxytocin and decreased parvalbumin staining in the cilia. PMID: 15964694
  43. These results demonstrate that the absence of the parvalbumin disrupts the regulation of Purkinje cell firing rate and rhythmicity. PMID: 16115209
  44. Quantitative analysis of selected mitochondrial proteins revealed the PV-/- tibialis anterior mitochondria composition to be almost identical to that in wild-type soleus, but not in wild-type fast-twitch muscles. PMID: 16367751
  45. Density of parvalbumin-positive neurons does not alter during cortical plasticity in classical conditioning. PMID: 16413119
  46. Calcium-binding proteins may contribute to selective vulnerability and an early loss of function of large motor neurons in this SOD1-transgenic mouse model. PMID: 16546142
  47. In-strain embryo transfer had a differential influence on the numbers of amygdaloid parvalbumin-immunoreactive neurons of inbred C3H/HeN and DBA/2J mice. Maternal factors had a some impact on the numbers of PARV-ir neurons. PMID: 16860404
  48. The firing properties of four subtypes of parvalbumin-positive interneurons allow the neuron networks to perform an array of information-processing tasks within the basolateral amygdala. PMID: 17234587
  49. Analysis revealed a slightly increased activity in mice lacking parvalbumin as well as an increase in the characteristic speed during the first 8 day. PMID: 17275105
  50. Our results indicate that CB, PV and GABA show a dynamic pattern of colocalization in cells of the mouse basolateral amygdalar nucleus throughout development. PMID: 17681450

Show More

Hide All

Protein Families
Parvalbumin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*