Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Pglyrp1

Uniprot No.

O88593

Research Area

Cancer

Alternative Names

Pglyrp1; Pglyrp; Pgrp; Pgrps; Tag7; Peptidoglycan recognition protein 1; Cytokine tag7; Peptidoglycan recognition protein short; PGRP-S

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

19-182aa

Target Protein Sequence

FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

26.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity. Forms an equimolar complex with heat shock protein HSPA1A and induces programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor on the target cell membrane. In addition, acts in complex with the Ca(2+)-binding protein S100A4 as a chemoattractant able to induce lymphocyte movement. Mechanistically, this complex acts as a ligand of the chemotactic receptors CCR5 and CXCR3 which are present on the cells of the immune system. Promotes also the activation of lymphocytes that become able to kill virus-infected cells as well as tumor cells by modulating the spectrum of their target-cell specificity. Induction of cytotoxicity on monocyte surface requires interaction with TREM1 receptor.

Gene References into Functions

Tag7 activates lymphocytes capable of Fasl-Fas-dependent contact killing of virus-infected cells. PMID: 29083508
Both compounds down regulated mucin 5 subtype B, and peptidoglycan recognition protein 1 in vaginal tissue PMID: 25333937
Pglyrp1 expressed by hematopoietic cells, such as alveolar macrophages, mediates house dust mite-induced airway inflammation by up-regulating the production of C-C chemokines that recruit eosinophils and Th2 cells to the lung. PMID: 23808363
Peptidoglycan recognition protein 1 enhances experimental asthma by promoting Th2 and Th17 and limiting regulatory T cell and plasmacytoid dendritic cell responses. PMID: 23420883
Mammalian PGRP-S functions in intracellular killing of bacteria. Only bacterial recognition by PGRP-S, but not its effector function, is conserved from insects to mammals PMID: 12649138
mPGRP-L has activity and other properties identifying it as the N-acetylmuramoyl-L-alanine amidase protein present in mammalian sera PMID: 12821140
Peptidoglycan recognition protein tag7 forms a cytotoxic complex with heat shock protein 70 in solution and in lymphocytes. PMID: 14585845

Hide All

Subcellular Location

Cytoplasm. Secreted. Note=Exists in both soluble and membrane-associated forms.

Protein Families

N-acetylmuramoyl-L-alanine amidase 2 family

Tissue Specificity

Strongly expressed in spleen and lung. Also detected in brain and thymus. In the lung, expressed in the intraalveolar space, in the brain, expressed in the Purkinje cells of the cerebellum and in certain layers of neurons in the hippocampus. Also detected

Database Links

KEGG: mmu:21946

STRING: 10090.ENSMUSP00000032573

UniGene: Mm.21855

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP017862MO
MSDS	MSDS
Size	US$306
	Order now
Image	Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017862MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pglyrp1. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017862MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pglyrp1.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Peptidoglycan recognition protein 1 (Pglyrp1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage