Recombinant Mouse Pituitary homeobox 1 (Pitx1)

In Stock
Code CSB-EP018042MO
Abbreviation Recombinant Mouse Pitx1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Pitx1
Uniprot No.
Research Area
Signal Transduction
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-315aa
Target Protein Sequence
MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKERGGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.9 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb. Can independently activate and synergize with PIT-1 on pituitary-specific target gene promoters, thus may subserve functions in generating both precursor and specific cell phenotypes in the anterior pituitary gland and in several other organs. Can activate pituitary transcription of the proopiomelanocortin gene.
Gene References into Functions
  1. Pitx1 distal enhancer loss have only mild effects on Pitx1 expression in the hindlimb and no overt effects on hindlimb or mandibular morphology. PMID: 29549111
  2. data suggest that PITX1 promotes chondrogenesis and myogenesis in the hindlimb by direct regulation of several key members of the cartilage and muscle transcriptional networks. PMID: 29273440
  3. Results indicate autonomously programmed differences in forelimb and hindlimb cartilage precursors of the limb skeleton are controlled, at least in part, by Pitx1 and suggest this has an important role in generating distinct limb-type morphologies. PMID: 28746404
  4. Pitx1 targets sites that are in a similar chromatin state in Forelimbs (FLs) and hindlimbs and controls expression of patterning genes as well as the chondrogenic program. PMID: 28807899
  5. Pitx1 influences hindlimb morphology both through the activation of hindlimb-specific enhancers as well as through the hindlimb-specific modulation of enhancers that are active in both sets of limbs PMID: 23201014
  6. The results suggest that PITX2 and PITX1 have overlapping roles in thyrotroph function and response to hypothyroidism. PMID: 21964592
  7. PITX1 haploinsufficiency may cause a developmental field defect preferentially affecting the lateral lower leg. PMID: 21775501
  8. It was shown that, firstly, Pitx1 influences hindlimb outgrowth by regulating Tbx4 expression levels and that, subsequently,Pitx1 shapes hindlimb bone and soft tissue morphology independently of Tbx4. PMID: 22071103
  9. These findings provide evidence that c-Abl participates in modulating Pitx1 expression in the apoptotic response to DNA damage. PMID: 20563669
  10. Thus, Pitx1 and Pitx2 genes are required for sustained hindlimb bud growth and formation of hindlimbs PMID: 12441290
  11. expression during cardiovascular development PMID: 12858527
  12. PITX1 autoregulation depends on DNA-binding and trans-activation domains of Pitx1 and it may be responsible for establishment and/or maintenance of the Pitx1 expression domain. PMID: 14512705
  13. Results suggest that pituitary homeobox 1 (Pitx-1) can direct transactivation of the mouse gonadotropin-releasing hormone receptor gene, in part by DNA binding and in part by an action of Pitx-1 as a cofactor for AP-1 PMID: 15226417
  14. Although PITX1 protein is present in expression pattern similar to PITX2 throughout pituitary development, it has less prominent role than PITX2. PMID: 15761027
  15. These results demonstrate that Pitx1, but not Tbx4, determines the morphological identity of hindlimb tissues. PMID: 16989801
  16. Deletion of the Pitx1 genomic locus affects mandibular morphogenesis and expression of the Barx1 and Tbx1 genes. PMID: 18082678

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Paired homeobox family, Bicoid subfamily
Tissue Specificity
Expressed in primordial Rathke pouch, oral epithelium, first branchial arch, duodenum, and hindlimb.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*