Recombinant Mouse Protein S100-A9(S100a9)

Code CSB-EP020642MO
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names S100a9
Uniprot No. P31725
Research Area Others
Alternative Names S100a9; Cagb; Mrp14; Protein S100-A9; Calgranulin-B; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9
Species Mus musculus (Mouse)
Source E.coli
Expression Region 2-113aa
Target Protein Sequence ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 28.9kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include
Gene References into Functions
  1. These results suggest that immunological functions of MRP14, and possibly also the associated molecule MRP8, are different between BALB/c and C57BL/6 mice, at least in the response to LPS. PMID: 29253495
  2. the biologically potent dimeric form of S100A9 is induced in vivo in situations of tumor burden or inflammatory challenge. PMID: 29679568
  3. findings reveal unexpected gene expression differences between WT and KO mice at a young age (in the absence of physiological stress), and address the hypothesis that Mrp8 and Mrp14 accumulation promotes age-related inflammation PMID: 27224926
  4. An excessive expansion of monocytic-myeloid-derived suppressor cells in S100A9-/- neonates compared to wild-type neonates. This strong baseline expansion was associated with hyperinflammatory responses during endotoxemia and fatal septic courses PMID: 27993995
  5. Data support a role of S100A9 to initiate and amplify the neutrophilic inflammation in asthma, possibly via inducing IL-1beta, IL-17 and IFN-gamma. PMID: 28847516
  6. S100A9 knockdown almost completely abrogated the effects of IRF7 deletion on granulocytic myeloid-derived suppressor cells development and tumor metastasis. PMID: 28092673
  7. vitro studies on the mechanisms/pathways involved in leukemic cell differentiation revealed that binding of S100A9 to Toll-like receptor 4 (TLR4) promotes activation of p38 mitogen-activated protein kinase, extracellular signal-regulated kinases 1 and 2, and Jun N-terminal kinase signaling pathways, leading to myelomonocytic and monocytic AML cell differentiation. PMID: 28137827
  8. these results indicate that CD14 is a co-receptor of TLR4 in the S100A9-induced cytokine response. PMID: 27228163
  9. Mechanistic studies showed that in MDSCs, ATF3 was transrepressed by the GC receptor GR through direct binding to the negative GR-response element. S100A9 is the major transcriptional target of ATF3 in Granulocytic Myeloid-derived Suppressor Cells. PMID: 27573240
  10. CHI3L1-mediated cell proliferation/survival involves partial downregulation of the pro-apoptotic S100A9 protein that is highly expressed during the acute phase of colitis, by binding to the S100A9 receptor, RAGE (Receptor for Advanced Glycation End products). PMID: 26431492
  11. MRP8/14 serves in an unexpected protective role for the lung in staphylococcal pneumonia. PMID: 25792636
  12. Canonical Wnt signaling was decreased after induction of experimental OA in S100A9-deficient mice. PMID: 26360647
  13. In a model of liver injury induced hepatocellular carcinoma, mice lacking S100A9 express reduced neutrophil chemokines and are protected from HCC. PMID: 25879839
  14. Data indicate that calgranulin B (S100A9) is essential for in vivo toll like receptor 3 (TLR3) signaling. PMID: 26385519
  15. Myocardial gene and protein expression of S100A9 was also significantly increased in mice 1 day after debanding that had been preceded by 3 days or 1 week of transverse aortic constriction. PMID: 25820336
  16. Identified TLR2 and S100A8/S100A9 as key regulators of hepatic CXCL-2 expression and neutrophil recruitment. PMID: 24333183
  17. Data shows that S100A9 protein is not required for liver tumors to form although it is highly upregulated in liver cancers. PMID: 25331529
  18. The mechanism of S100A9 is able to coincide with the inflammatory process. PMID: 24586443
  19. S100A9, potentially with its partner S100A8, makes a major contribution in the host response to pneumococcal infection by increasing circulating neutrophils principally regulation of G-CSF production. PMID: 24776746
  20. data identify a molecular pathway of thrombosis that involves platelet MRP-14 and CD36 and suggest that targeting MRP-14 has potential for treating atherothrombotic disorders, including MI and stroke. PMID: 24691441
  21. The endogenous TLR-4 ligand Mrp8/14 has a pro-inflammatory role to a regulatory function in adaptive immunity. PMID: 23188082
  22. Elevated S100A9 expression in colonic epithelial cells mediated by an IL-6/STAT3 signaling cascade may play an important role in the development of colitis. PMID: 22962574
  23. S100A9 and TLR4 appear to be involved in promoting tumor growth in two different tumor models and pharmacological inhibition of S100A9-TLR4 interactions is a novel and promising target for anti-tumor therapies. PMID: 22470535
  24. The absence of MRP-14 markedly increased T-cell activation and exacerbated allograft rejection, indicating a previously unrecognized role for MRP-14 in immune cell biology. PMID: 22144572
  25. S100A9 expression in nonmyeloid cells is likely to contribute to atherosclerosis. PMID: 21382888
  26. Neutrophil-derived protein S100A9 is a key player in the suppression of pro-inflammatory activation of macrophages. PMID: 19656587
  27. results suggest that S100a9 induced by Abeta or CT contributes to cause inflammation, which then affects the neuropathology including amyloid plaques burden and impairs cognitive function PMID: 20098622
  28. Upregulation and signaling of Mrp-8 and-14 contribute to neuroinflammation and the progression of ischemic damage. PMID: 19835955
  29. MRP-14(-/-) mice showed no obvious phenotype and similar induced inflammatory response but myeloid cells were less dense. MRP-14 and MRP-8 are apparently dispensable for many myeloid cell functions PMID: 12640137
  30. S100A9 plays a role in the inflammatory response to lipopolysaccharide by inducing the release of neutrophils from the bone marrow and directing their migration to the inflammatory site. PMID: 12928412
  31. MRP14 deficient mice show a diminished recruitment of granulocytes into the granulation tissue during wound healing in vivo. PMID: 15331440
  32. the C-terminus of S100A9 protein has a modulator effect on the function of adherent peritoneal cells PMID: 15953992
  33. This study defines a lesion in S100A9 null neutrophils associated with inflammatory agonist-induced IP3-mediated Ca2+ release that is manifested at the level of PLCbeta. PMID: 16814379
  34. These data demonstrate that the C-terminus of S100A9 protein interferes with control mechanisms of inflammatory pain. PMID: 16920226
  35. Bronchoalveolar lavage fluid protein S100A9 is cleaved by matrix metalloproteinases 2 and 9 and is essential for regulating inflammatory pathways in experimental asthma. PMID: 17082650
  36. Report showed S100A9 was expressed murine bone and cartilage cells and may contribute to calcification of the cartilage matrix and its replacement with trabecular bone, and to regulation of redox in bone resorption. PMID: 17636430
  37. During the early phase of an experimental streptococcal lung infection model, antimicrobial protein S100A9 is expressed in pneumocytes and may play a critical role in regulating innate immunity and transepithelial migration of macrophages and neutrophils. PMID: 18292562
  38. The delay in neutrophil recruitment in F. tularensis subsp. novicida-infected mice correlates with upregulation of cytokines, bacteremia, and release of high-mobility group box-1 and S100A9. PMID: 18411294
  39. Data show that the degree of intrapancreatic trypsinogen activation is influenced by the extent of leukocyte infiltration into the pancreas which, in turn, depends on the presence of S100A9 that is secreted from polymorph nuclear leukocytes. PMID: 18452188
  40. RAGE, carboxylated glycans and S100A8/A9 play essential roles in tumor-stromal interactions, leading to inflammation- PMID: 18689872
  41. Regardless of their in vivo location, myeloid-derived suppressor cells synthesize and secrete the inflammatory mediator S100A9 that accumulates in the serum of tumor-bearing mice. PMID: 18802069
  42. This study demonstrates that tumor-induced up-regulation of S100A9 protein is critically important for accumulation of myeloid-derived suppressor cells and reveals a novel molecular mechanism of immunological abnormalities in cancer. PMID: 18809714
  43. S100A9 is upregulated after arylhydrocarbon receptor activation and involved in thymocyte emigration. PMID: 16114106

Show More

Hide All

Subcellular Location Secreted, Cytoplasm, Cytoplasm, cytoskeleton, Cell membrane, Peripheral membrane protein
Protein Families S-100 family
Database Links

KEGG: mmu:20202

STRING: 10090.ENSMUSP00000070842

UniGene: Mm.2128

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1