Recombinant Mouse Protein flightless-1 homolog (Flii), partial

Code CSB-EP884922MO
Abbreviation Recombinant Mouse Flii protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Flii
Uniprot No.
Research Area
others
Alternative Names
Flii; Fli1; FliihProtein flightless-1 homolog
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
495-827aa
Target Protein Sequence
VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGSSLDPRFVFLLDQGLDIYVWRGAQATLSNTTKARLFAEKINKNERKGKAEITLLVQGQEPPGFWDVLGGEPSEIKNHVPDDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPGMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHTVVSRSLEGTE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Essential for early embryonic development. May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration, by inhibiting Rac1-dependent paxillin phosphorylation.
Gene References into Functions
  1. Fluorescence resonance energy transfer experiments showed that FliI-NMMIIA interactions require Ca(2+) influx. We conclude that Ca(2+) influx through the TRPV4 channel regulates FliI-NMMIIA interaction, which in turn enables generation of the cell extensions essential for collagen remodeling PMID: 28526784
  2. Flii genetic expression is enhances tissue regeneration, after claw amputation. PMID: 27595936
  3. Studies suggest that Flii enhances cutaneous squamous cell carcinoma progression by decreasing apoptosis and enhancing tumor cell invasion. PMID: 26497552
  4. P-Rex1 stimulates migration through enhancing the interaction between Rac1 and the actin-remodelling protein. PMID: 26887924
  5. Genes downstream from Flii, including TGF-beta1 and TGF-beta3, showed significantly altered expression confirming a functional effect of the Rhodamine-Flii small interfering RNA on gene expression PMID: 25838352
  6. FliI interacts with NMMIIA to promote cell extension formation, which enables collagen remodeling in fibroblasts. PMID: 25877872
  7. FLII functions in PPARgamma activation as a molecular switch to repress transcriptional activity by interrupting formation of the PPARgamma/RXRalpha complex. PMID: 25479590
  8. LRRFIP2 inhibits NLRP3 inflammasome activation by recruiting the caspase-1 inhibitor Flightless-I, thus outlining a new mechanism for negative regulation of NLRP3 inflammasome. PMID: 23942110
  9. increasing the level of Flii in diabetic mouse wounds led to increased TLR4 and NF- kappa B production. Treatment of murine diabetic wounds with neutralising antibodies to Flii led to an improvement in healing with decreased expression of TLR4 PMID: 23555084
  10. Using a mouse model of epidermolysis bullosa acquisita, the effect of "mopping up" Flii using Flii-neutralizing antibodies before, during, and after blister formation was determined. PMID: 23223144
  11. Flii is constitutively secreted from macrophages and fibroblasts and is present in human plasma. PMID: 22718342
  12. FliI regulates cell migration through its localization to focal adhesions and its ability to cap actin filaments, which collectively affect focal adhesion maturation. PMID: 22581781
  13. Data show that mice with elevated Flii expression exhibit impaired wound healing. PMID: 21786402
  14. Overexpression of Flii produced severe blistering post-induction of EBA, while decreased Flii reduced blister severity, elevated integrin expression, and improved ColVII production. PMID: 21984127
  15. show that Flii modulation of focal adhesions and filamentous actin stress fibers is Rac1-dependent PMID: 21430700
  16. Flii appears to have a positive role in the regeneration of hair follicles, contrary to its negative influence on wound healing in skin PMID: 21191408
  17. performs an essential function in early embryonic development PMID: 11971982
  18. Directly interferes with the formation of the TLR4-MyD88 signaling complex. PMID: 16424162
  19. FliI is a contributing factor to impaired healing and strategies aimed at decreasing FliI levels in elderly skin may improve wound repair. PMID: 18191609
  20. Flii may regulate wound repair through its effect on hemidesmosome formation and integrin-mediated cellular adhesion and migration. PMID: 19212345
  21. These findings support the model that CISK phosphorylates FLII and activates nuclear receptor transcription and suggest a new cell survival signaling pathway mediated by PI 3-kinase and CISK. PMID: 19293151

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell junction, focal adhesion. Note=Colocalizes to actin-rich structures in blastocysts and, together with HRAS, RHOA and CDC42, in migrating fibroblasts. Localizes to centrosomes.
Tissue Specificity
Expressed in blastocyst.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*