Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Rac2

Uniprot No.

Q05144

Research Area

Immunology

Alternative Names

Protein EN-7;p21-Rac2

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-189aa

Target Protein Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Datasheet & COA

Please contact us to get it.

Target Background

Function

Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Augments the production of reactive oxygen species (ROS) by NADPH oxidase.

Gene References into Functions

These data reveals an intricate balance between activation of WASp and Rac2 signalling pathways in dendritic cells. PMID: 27425374
Rac2 signaling axis is critical in the regulation of macrophage differentiation and lung fibrosis in vivo. PMID: 28817691
Rac2 GTPase is activated downstream of alpha4beta1 integrin and the MCSF receptor to control tumor growth, metastasis and macrophage differentiation. PMID: 24770346
Rac2-deficient animals have higher rates of mortality in pulmonary fibrosis. PMID: 24970330
the levels of beta-catenin were reduced and not able to prevent the negative effect of Rac2 on PLD2 activity PMID: 23898047
Rac2 is essential for NET formation via pathways involving ROS and NO. PMID: 21712395
Rac2 drives the physiological process of late chemotaxis, and has a dual (enhancing and inhibitory) effect on PLD2-induced chemotaxis. PMID: 21444720
Rac2(-/-) osteoclasts showed a marked defect in chemotaxis toward a point source of CSF1, with a dramatic reduction in migratory rate. PMID: 21110188
Sbds is required for osteoclastogenesis by regulating monocyte migration via Rac2 and osteoclast differentiation signaling downstream of RANK. PMID: 21084708
Data show that Rac2 deficiency exhausts the LSC pool in vivo through impairment of oncogene-induced proliferation and survival signals. PMID: 20407032
Rac2 is directly implicated in the regulation of signaling thresholds for ligation of B cell antigen receptors and CD19, and the regulation of chemokine responses that determine the distribution of B cell populations. PMID: 11907095
Rac2-deficient mice display perturbed T-cell distribution and chemotaxis, but only minor abnormalities in T Helper 1 responses. PMID: 12067410
TRQQKRP motif in Rac2 protein is required for efficient prenylation and correct intracellular localization of Rac2 protein and is essential for Rac2 to mediate a variety of its biologic functions PMID: 12176888
Rac2 regulates mast cell protease gene expression in bone marrow-derived mast cells PMID: 12370311
Interleukin-3 (IL-3)-induced activation of endogenous Rac-2. PMID: 12384416
Rac2 plays a dominant role in FMLP-activated neutrophil responses, reflecting a greater activation of Rac2 and a preferred role for Rac2 to stimulate downstream functional responses not compensated for by enhanced Rac1 activation of Rac2null neutrophils. PMID: 12391220
evidence that the alpha4beta1 receptor in blood cells has evolved a Syk-Rac2 signaling axis to transmit signals required for integrin-directed migration suggesting that Syk kinase in part encodes myeloid Rac2 specificity in vivo PMID: 12917394
specific sequences in Rac that specify subcellular localization and determine the specificity of Rac2 in neutrophil chemotaxis and superoxide generation PMID: 15170212
confirm that Rac2 is the primary regulator of actin assembly providing the molecular motor for neutrophil translocation during chemotaxis PMID: 15308574
Genetic evidence is provided that although Rac2 is a relatively minor isoform in murine macrophages, it plays a nonoverlapping role with Rac1 to regulate host defense functions in this phagocyte lineage. PMID: 15528331
Rac2(-/-) stem/progenitor cells exhibit abnormal interaction with the hematopoietic microenvironment, which leads to defective long-term engraftment. PMID: 15749928
Rac2 controls chemotaxis and superoxide production via distinct pathways and is critical for development of myeloid colonies in vitro PMID: 15814684
Rac2 has a positive charge-independent mechanism in which Rac2 initially targets to endomembranes and then these endomembranes fuse to the phagosome. PMID: 16081809
Rac2 significantly contributes to oxidant production at the wound site and supports the healing process. PMID: 18068132
critical role for Rac2 in mediating B cell adhesion PMID: 18191593
In the genetic absence of Rac2, the anabolic response to PTH is increased. PMID: 18467443
Rac2 in hematopoietic cells regulates leukocyte lineage distribution and Rac2 in nonhematopoietic cells might contribute to regulating circulating neutrophil counts. PMID: 18583316
PI3K and Src-ELMO-Dock2 pathways work in parallel to activate Rac2 and modulate chemotaxis in response to a CXCL8 gradient in neutrophils. PMID: 18662984
RAC2 in vascular endothelial cells is obligately required for the postnatal neovascular response and alphavbeta3/ alpha4beta1/alpha5beta1 integrin-directed migration on vitronectin, H296 and CH271, fibronectin fragments, respectively. PMID: 19123268
Suppressed hindlimb perfusion in Rac2-/- and Nox2-/- mice does not result from impaired collateral growth. PMID: 19151256
GTPase Rac2 plays a critical role in antigen crosspresentation selectively in this dendritic cell subpopulation PMID: 19328020
cells. Results showed that immortalized WT2 cells were able to differentiate into mature, multinucleated, functional, tartrate-resistant acid phosphatase-positive osteoclasts. PMID: 19649754
Lung injury in response to immune complex deposition is dependent on Rac2 in alveolar macrophages and neutrophils. PMID: 19801448

Hide All

Subcellular Location

Cytoplasm. Membrane; Lipid-anchor.

Protein Families

Small GTPase superfamily, Rho family

Database Links

KEGG: mmu:19354

STRING: 10090.ENSMUSP00000036384

UniGene: Mm.1972

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP019248MO
Abbreviation	Recombinant Mouse Rac2 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Ras-related C3 botulinum toxin substrate 2 (Rac2)

Product Details

Customer Reviews and Q&A

Target Background

×CloseMessage